IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. human brain cDNA library (Clontech) Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation LRRK2 regulates synaptic vesicle endocytosis. LRRK2 regulates synaptic vesicle endocytosis. Exp. Cell Res. (0014-4827) 2008 imex curation Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. sunghoe@gist.ac.kr,wseol@inje.ac.kr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Shin N., Jeong H., Kwon J., Heo H.Y., Kwon J.J., Yun H.J., Kim C.H., Han B.S., Tong Y., Shen J., Hatano T., Hattori N., Kim K.S., Chang S., Seol W. Parkinsons - Interactions investigated in the context of Parkinsons disease I cannot find any image legends for the Supplementary figures - so have entered Supp Fig 2 into Expt 7 on the basis of what is stated in the text. -other figures do not look to be an issue. rat hippocampal neurons sunghoe@gist.ac.kr,wseol@inje.ac.kr Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a1l1j8_rat Rab5b Rab5b_predicted rCG_42413 protein protein rat Rattus norvegicus (Rat) Rat MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNPGGAAGRSRGVDLHEQAQQNKSQCCSN D47AD32F60F8B591 rab5b_human Ras-related protein Rab-5B RAB5B protein protein human Homo sapiens Human MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN D47AD834BCF8B591 f1lnj1_rat Non-specific serine/threonine protein kinase Lrrk2 protein protein rat Rattus norvegicus (Rat) Rat MASGACQGCDEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDILVFTYSDRASKLFEGKNVHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKITLLILDEECDVFLLIFDAMHRYSANEEVQKLACKALHVLFERVSEEQLTEFVENKDYMTLLSTFRSFKRDEEIVHHVLCCLHSLAVTCSNVEVLMSGNVRCYNIVVEAMKTFPTSENIQEVSCSLLHKLTLGNFFNILVLNEVHVFVVKAVQRYPENVALQISALSCLALLTETIFLNQDLEERSETQENSDEDSEKPFWLEPCYKALMRHRKNKHVQEAACWALNNLLMYQSSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQRHAQVPEVAESGCKMLSHLFEGSNPSLDTVAAVIPKILTVMRTHGTSLSVQLEALRALLHFVVPGVSEDSRDDSRCQPNVLRTQCFRTDIHKLVLAALNRFIGNPGIQKCGLKVISSFAHLPDALEMLSLHGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTVLSMLDLSVSFSKLLVHYSFDVVMFHQMSSGVLEQKDEQFLNLCCKCFAKVAVDDELKSKMLERACDQNNSIMVECLLLLGADANQAKGATSLIYQVCEKESSPKLVELLLNSGCREQDVRKALTVSIQKGDNQVISLLLRRLALDLANNSICLGGFCIGKLDPSWLGPLFPDKSSNLRKQTNAGSVLARKVLRYQMRNTLQEGVASGSEGNFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKKKSNSVSVGEVYRDLALQRCSPNAQRHSSSLGPVFDHEDLLRRKRKILSSDESLRSSRLQSHTRQSDSSSSLASEREHITSLDLSANELKDIDALGQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLTHLDLHSNKFATFPSFMLKMPSVIHLDASRNDIGPTVVLDPVVKCPSLKQFNLSYNQLSSIPENLDQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPEDFLEACPKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIEHLPGPAHWKSLNLRELIFSKNQISTLDLSENPHIWSRVEKLHLSHNKLKEIPPEIGRLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKSELGMQGATVGIDVRDWPIQIRGKRKKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACIGKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVKEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMAQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDSRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGNRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHIFIPKDITVECIAATNLNSKRATLWLGCGNTEKGQLSLLDLNTERYSYEEVTDSRILCLALVHLAAEKESWVVCGTQSGALLVINAEDETRRHTLDKMTDSVTCLYCNSFAKQSKQSHFLLVGTADGNLMIFEDKTIKCKGAAPLKTLHIGDVSTPLMCLSESMNSSERHITWGGCGTKIFSFSNDFTIQKLIETRTNQLFSYSAFSDSNIIAVAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKINKDSKHKLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGTQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DB5CA86E1E96E716 rab5b_mouse Ras-related protein Rab-5B Rab5b protein protein mouse Mus musculus Mouse MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN mint Protein transport. Probably involved in vesicular traffic D47AD834BCF8B591 rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET DIP protein Q15276 original sequence version: 59 CAAF91638B8ED516 lrrk2-rab5b 3 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait lrr_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure lrrk2-rab5b-1 6 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1A lrrk2-rab5b-2 4 13 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1B rab5b-lrrk2-2 4 13 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role ancillary ancillary chemical synthesis Chemical synthesis (Chemical synthesis) association association 1C Interactions of LRRK2 and mutants were GTP dependant. rab5b-lrrk2-3 2 8 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait physical association physical association 1D lrrk2-rab5b-3 1 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 1D lrrk2-rab5b-4 5 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 3A Most of the LRRK2 (perinuclear) aggregates co-localized with Rab5b aggregates. I cannot see what the effect of the mutations are meant to be from either the text (nowt stated) or the image :- the G2019S also is showing colocalisation, and according to the type of arrow used so is the R1441C mutant - but I dont see any yellow colour. lrrk2-rab5b-5 7 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 3B (Supp figure 2)