mbinfo MBInfo http://www.mechanobio.info/ Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Nat. Cell Biol. (1465-7392) 2007 imex curation Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro peptide array peptide array antibody detection identification by antibody antibody detection Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk Accepted 2013-JUN-04 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2007 Only protein-protein interactions imex curation Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Nat. Cell Biol. (1465-7392) 2007 imex curation Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk Accepted 2013-JUN-04 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2007 Only protein-protein interactions imex curation Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Nat. Cell Biol. (1465-7392) 2007 imex curation Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk Accepted 2013-JUN-04 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2007 Only protein-protein interactions imex curation Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Nat. Cell Biol. (1465-7392) 2007 imex curation Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk Accepted 2013-JUN-04 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2007 Only protein-protein interactions imex curation Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Focal adhesion kinase controls actin assembly via a FERM-mediated interaction with the Arp2/3 complex. Nat. Cell Biol. (1465-7392) 2007 imex curation Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Serrels B., Serrels A., Brunton V.G., Holt M., McLean G.W., Gray C.H., Jones G.E., Frame M.C. see email for comments The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. The pull down assays using GST-N-WASP-VCA (Fig S2a) could not be curated since the source of GST-N-WASP-VCA could not be identified. m.frame@beatson.gla.ac.uk Accepted 2013-JUN-04 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Cell Biol. (1465-7392) 2007 Only protein-protein interactions imex curation arp3_bovin Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 Actin-2 protein protein bovin Bos taurus (Bovine) Bovine MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS DIP protein P61157 original sequence version: 44 DIP protein P61157 original sequence version: 74 DIP protein P61157 original sequence version: 86 23E5564198B81C63 arp3_mouse Actin-related protein 3 Actin-like protein 3 Actr3 Arp3 protein protein mouse Mus musculus Mouse MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 806FED7A08ABA455 arp2_bovin Actin-related protein 2 ACTR2 ARP2 Actin-like protein 2 protein protein bovin Bos taurus (Bovine) Bovine MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR DIP protein A7MB62 original sequence version: 6 DIP protein A7MB62 original sequence version: 35 DIP protein A7MB62 original sequence version: 47 1BFA6B442ED1A797 wasl_mouse Neural Wiskott-Aldrich syndrome protein Wasl protein protein mouse Mus musculus Mouse MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYGSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPPSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPAPSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFEDDDEWED DIP protein Q91YD9 original sequence version: 57 F5ABF44DF9A9F716 fak1_chick Focal adhesion kinase 1 PTK2 FAK FAK1 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase p125FAK protein protein chick Gallus gallus (Chicken) Chicken MAAAYLDPNLNHTPSSSAKTHLGTGMERSPGAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANNEKQGVRSHTVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQPNHYQVSGYSGSHGIPAMAGSIYPGQASLLDQTDSWNHRPQEVSAWQPNMEDSGTLDVRGMGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLVMKPDVRLSRGSIEREDGGLQGPAGNQHIYQPVGKPDHAAPPKKPPRPGAPHLGSLASLNSPVDSYNEGVKIKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH 8051154219B953B9 fak1_mouse Focal adhesion kinase 1 Ptk2 Fadk Fak Fak1 Kiaa4203 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase p125FAK protein protein mouse Mus musculus Mouse MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH 4B7453C5D81F0F63 actr3-ptk2 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 2a, 2b (lanes 1 and 5), 2c (middle panel, lanes 2,3). The interaction of FAK with Arp3 was stronger in suspended MEFs, compared with adherent cells (Fig 2b, lane 1 Vs lane 5). The interaction decreased with increasing times after the suspended cells were re-plated on Fibronectin surfaces (Fig 2C, lane 3 Vs lane 4). Arp3 interacted only with dephosphorylated forms of FAK in suspended cells or immediately after replating on fibronectin surfaces (Fig 2c, middle panel Vs bottom panel). wasl-ptk2 2 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig S2b (lane 1). actr3-ptk2-1 4 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1, fig 3. Colocalization of Arp3 with FAK is observed at the tips in control cells (Fig. 1d; arrows) -early spreading adhesions. After 2h Arp3 no longer colocalized with FAK. There would appear to be increased Arp3/FAK co-localisation with the FAKY397F mutant as shown by the increased intensity of yellow/orange colouration. ptk2-actr3-1 3 10 unspecified role unspecified role bait bait ferm subdomain 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Fig 5A, 4C, 4D, 6A. ptk2-actr3-3 5 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ferm domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] 6 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] association association Fig 4e. GST-FAK-FERM bound more strongly to the Arp3 component and less strongly to the Arp2 component of the Arp2/3 complex. ptk2-actr3-5 1 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ferm domain peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ferm domain peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Fig 5b, 5c. ptk2-actr3-7 3 10 unspecified role unspecified role bait bait Q00944:p.Tyr397Phe mutation mutation certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:25:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr397phe' Tue Jun 30 18:50:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr397Phe' n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q00944:p.Tyr397Phe mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 14:46:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr397phe' Tue Jun 30 18:21:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr397Phe' The Y397F (non-phosphorylated) mutation is required for the FAK-FERM [37-413] region to bind to Arp3. ferm domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain The FAK-FERM domain [37-413] binds to Arp3, only when the tyrosine at 397 is mutated to a non-phosphorylated amino acid phenylalanine [Y397F]. The wild type FAK-FERM [37-378] with a phosphorylated tyrosine at 397, does not bind to Arp3 [Fig 4c, 4d]. ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey bovin-brain Bos taurus brain brain Brain [cerebrum] physical association physical association Fig 4c, 4d. The FAK-FERM domain [37-413] binds to Arp3, only when the tyrosine at 397 is mutated to a non-phosphorylated amino acid phenylalanine [Y397F]. The wild type FAK-FERM [37-378] with a phosphorylated tyrosine at 397, does not bind to Arp3 [Fig 4c, 4d]. ptk2-actr3-10 3 10 competitor competitor competitor unspecified role unspecified role peptide_a_and_b sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait ferm domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey association association Fig 6a.