bhf-ucl A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. Mol. Cell. Biol. (0270-7306) 2007 imex curation McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown Fig 5 Species of GST-NUFIP confirmed as human in ref 6: identified a human zinc-finger-containing protein NUFIP following screen of a human B-lymphocyte cDNA library Fig 2 Species of Fibrillarin unknown Species of 15.5K (NHP2L1) confirmed as human in ref 39: PMID:10545122: We characterize an evolutionarily conserved 15.5 kDa protein of the HeLa [U4/U6.U5] tri-snRNP n.j.watkins@ncl.ac.uk 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown n.j.watkins@ncl.ac.uk Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2007 imex curation A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. Mol. Cell. Biol. (0270-7306) 2007 imex curation McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown Fig 5 Species of GST-NUFIP confirmed as human in ref 6: identified a human zinc-finger-containing protein NUFIP following screen of a human B-lymphocyte cDNA library Fig 2 Species of Fibrillarin unknown Species of 15.5K (NHP2L1) confirmed as human in ref 39: PMID:10545122: We characterize an evolutionarily conserved 15.5 kDa protein of the HeLa [U4/U6.U5] tri-snRNP n.j.watkins@ncl.ac.uk 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown n.j.watkins@ncl.ac.uk Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2007 imex curation A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly. Mol. Cell. Biol. (0270-7306) 2007 imex curation McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown Fig 5 Species of GST-NUFIP confirmed as human in ref 6: identified a human zinc-finger-containing protein NUFIP following screen of a human B-lymphocyte cDNA library Fig 2 Species of Fibrillarin unknown Species of 15.5K (NHP2L1) confirmed as human in ref 39: PMID:10545122: We characterize an evolutionarily conserved 15.5 kDa protein of the HeLa [U4/U6.U5] tri-snRNP n.j.watkins@ncl.ac.uk 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography McKeegan K.S., Debieux C.M., Boulon S., Bertrand E., Watkins N.J. Cardiac - Interactions involving cardiac related proteins can expts in fig 6 be interpreted wrt protein binding? - I would say difficult. We assume the NOP proteins have bound to NUFIP but its not actually demonstrated so I would be inclined to ignore it. Figure 5, species of TAF9 (ref 31) unknown n.j.watkins@ncl.ac.uk Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2007 imex curation ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS DIP protein Q9Y230 original sequence version: 92 DIP protein Q9Y230 original sequence version: 120 DIP protein Q9Y230 original sequence version: 142 DIP protein Q9Y230 original sequence version: 180 54C78E9C587D975A pihd1_human PIH1 domain-containing protein 1 PIH1D1 NOP17 Nucleolar protein 17 homolog protein protein human Homo sapiens Human MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS 074A9CD4037A4882 nop58_human Nucleolar protein 58 NOP58 NOL5 Nucleolar protein 5 NOP5 HSPC120 protein protein human Homo sapiens Human MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED DIP protein Q9Y2X3 original sequence version: 137 27CD73CFF5B9A556 nufp1_human Nuclear fragile X mental retardation-interacting protein 1 Nuclear FMRP-interacting protein 1 NUFIP1 protein protein human Homo sapiens Human MAEPTSDFETPIGWHASPELTPTLGPLSDTAPPRDSWMFWAMLPPPPPPLTSSLPAAGSKPSSESQPPMEAQSLPGAPPPFDAQILPGAQPPFDAQSPLDSQPQPSGQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV DIP protein Q9UHK0 original sequence version: 84 318418FB08071001 ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK DIP protein Q9Y265 original sequence version: 82 DIP protein Q9Y265 original sequence version: 110 6095ADE692B1482B nh2l1_human NHP2-like protein 1 SNU13 High mobility group-like nuclear protein 2 homolog 1 NHP2L1 OTK27 SNU13 homolog U4/U6.U5 small nuclear ribonucleoprotein SNU13 U4/U6.U5 tri-snRNP 15.5 kDa protein protein protein human Homo sapiens Human MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV DIP protein P55769 original sequence version: null 78849EBB497089ED nop56_human Nucleolar protein 56 NOP56 NOL5A Nucleolar protein 5A protein protein human Homo sapiens Human MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEGVVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED 17D81E25DEBD052F taf9_human Transcription initiation factor TFIID subunit 9 Transcription initiation factor TFIID 31 kDa subunit Transcription initiation factor TFIID 32 kDa subunit RNA polymerase II TBP-associated factor subunit G STAF31/32 TAF9 TAF2G TAFII31 protein protein human Homo sapiens Human MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL DIP protein Q16594 original sequence version: 66 DIP protein Q16594 original sequence version: 105 DIP protein Q16594 original sequence version: 131 1925AEC65D6C84C7 ruvb1_mouse RuvB-like 1 Ruvbl1 Tip49 Tip49a 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 DNA helicase p50 protein protein mouse Mus musculus Mouse MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK 9AE73EFFBA194BA1 bcd1_human Box C/D snoRNA protein 1 ZNHIT6 BCD1 C1orf181 Zinc finger HIT domain-containing protein 6 Serologically defined breast cancer antigen NY-BR-75 protein protein human Homo sapiens Human MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDGEEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEEKVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKRPISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKLQFPQSQAEYIEKRVPDDKTINEILKPYIDPEKSDPVIRQRLKAYIRSQTGVQILMKIEYMQQNLVRYYELDPYKSLLDNLRNKVIIEYPTLHVVLKGSNNDMKVLHQVKSESTKNVGNEN 34A50A1C62E4F4E8 ruvb2_mouse RuvB-like 2 Ruvbl2 p47 protein protein protein mouse Mus musculus Mouse MATVAATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS 419D779972933308 nhp2l1-ruvbl2 1 14 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 2D ATP nhp2l1-ruvbl1 1 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 2D ATP nop56-nop58 2 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Fig 3B znhit6-nufip1-1 3 13 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5B nufip1-znhit6-1 3 13 unspecified role unspecified role prey prey purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5B znhit6-znhit6 3 13 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role prey prey purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5B nufip1-nufip1 3 7 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5B nufip1-ruvbl2-1 3 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5D nufip1-ruvbl1 3 12 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5D nufip1-ruvbl2-2 3 14 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5C ruvbl1-ruvbl2-7 3 14 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 5C znhit6-ruvbl2 1 13 unspecified role unspecified role bait bait purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5E ADP pih1d1-ruvbl1 1 5 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 12 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5F nufip1-nhp2l1 3 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5G nufip1-nop56 3 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 5G nufip1-nop58 3 6 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association Fig 5G nufip1-nhp2l1-1 3 9 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait purified purified gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association Fig 5G