mbinfo MBInfo http://www.mechanobio.info/ A paxillin tyrosine phosphorylation switch regulates the assembly and form of cell-matrix adhesions. A paxillin tyrosine phosphorylation switch regulates the assembly and form of cell-matrix adhesions. J. Cell. Sci. (0021-9533) 2007 imex curation Zaidel-Bar R., Milo R., Kam Z., Geiger B. Interaction detection: GST pull down. The source of paxillin inferred from the references of the contributing scientist and the source of FAK (endogenous) inferred from the cell extarcts (porcine aortic endothelial) used. benny.geiger@weizmann.ac.il 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zaidel-Bar R., Milo R., Kam Z., Geiger B. Interaction detection: GST pull down. The source of paxillin inferred from the references of the contributing scientist and the source of FAK (endogenous) inferred from the cell extarcts (porcine aortic endothelial) used. benny.geiger@weizmann.ac.il Accepted 2013-JAN-21 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation b3gbx7_pig FAK protein protein pig Sus scrofa (Pig) Pig RSFIILKATVSQPPGPGIIRHGDATDVRGIIQKIVDSHKVKHVACYGL 9100402BFC725CD5 paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F fak-pxn 1 3 unspecified role unspecified role unspecified role unspecified role P49023:p.[Tyr31Glu;Tyr118Glu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 18:11:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr31glu,tyr118glu' Tue Jun 30 16:36:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr31Glu;Tyr118Glu]' P49023:p.[Tyr31Phe;Tyr118Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Fri Jul 22 11:14:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr118phe,tyr31phe' Wed May 02 14:47:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr31phe,tyr118phe' Tue Jun 30 15:59:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr31Phe;Tyr118Phe]' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role unspecified role unspecified role pig-endothelium Pig endothelium endothelium Endothelial cells [endothelium] physical association physical association Fig 7A. Endogenous FAK was pulled down from Porcine aortic endothelial cell extracts.