IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. Neuroscience (0306-4522) 2006 imex curation Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. RZhao@som.umaryland.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. Have left in Parkinsons Dataset as Parkinsons is possibly now viewed as a Prion-like disease... RZhao@som.umaryland.edu Accepted 2014-FEB-12 by PPORRAS Neuroscience (0306-4522) 2006 Only protein-protein interactions imex curation Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. Neuroscience (0306-4522) 2006 imex curation Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. RZhao@som.umaryland.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. Have left in Parkinsons Dataset as Parkinsons is possibly now viewed as a Prion-like disease... RZhao@som.umaryland.edu Accepted 2014-FEB-12 by PPORRAS Neuroscience (0306-4522) 2006 Only protein-protein interactions imex curation prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 prnd_mouse Prion-like protein doppel Prnd Doppelganger PrPLP protein protein mouse Mus musculus Mouse MKNRLGTWWVAILCMLLASHLSTVKARGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERGAALRVAVDQPAMVCLLGFVWFIVK FC8B788259EE40F2 prnd-prnp 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A prnd-prnp-2 2 4 unspecified role unspecified role bait bait n_terminus_protein_a_and_cbp_tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey physical association physical association 6B The protein A tag was cleaved by TEV, and this resulted in CBP-Dpl rather than TAP-Dpl being detected by an anti-Dpl antibody. The two bands of PrPC detected in the TAP pull down (lanes 3+4) correspond to differentially glycosylated -non- and mono-glycosylated proteins, both of which were efficiently depleted by expression of PrP RNAi.