bhf-ucl Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. J. Cell Biol. (0021-9525) 2006 imex curation Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins meier@aecom.yu.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins Proteins were in vitro transcribed and translated from individual cDNAs in rabbit reticulocyte lysate in the presence of 35S-methionine. Origin of the following is according to authors' reference Wang & Meyer, 2004 PMID 15044956: rat NAP57, rat NOP10, rat NHP2, mouse GAR1 and rat HA-NOP10. NAF1 is human as per author statement in materials and methods. meier@aecom.yu.edu Accepted 2013-DEC-10 by ORCHARD J. Cell Biol. (0021-9525) 2006 imex curation Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. J. Cell Biol. (0021-9525) 2006 imex curation Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins meier@aecom.yu.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-143b Human bone osteosarcoma 143B 143b Human bone osteosarcoma 143B ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins E3 cell line used in figure 5 F is was generated from human U2OS tet-on cells. The source of GFP tagged NAF1 and NAP57 is human as per author statement. snoRNA E3 is rat. meier@aecom.yu.edu Accepted 2013-DEC-10 by ORCHARD J. Cell Biol. (0021-9525) 2006 imex curation Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. J. Cell Biol. (0021-9525) 2006 imex curation Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins meier@aecom.yu.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins Proteins were in vitro transcribed and translated from individual cDNAs in rabbit reticulocyte lysate in the presence of 35S-methionine. Origin of the following is according to authors' reference Wang & Meyer, 2004 PMID 15044956: rat NAP57, rat NOP10, rat NHP2, mouse GAR1 and rat HA-NOP10. NAF1 is human as per author statement is methods. meier@aecom.yu.edu Accepted 2013-DEC-10 by ORCHARD J. Cell Biol. (0021-9525) 2006 imex curation Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells. J. Cell Biol. (0021-9525) 2006 imex curation Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins meier@aecom.yu.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-143b Human bone osteosarcoma 143B 143b Human bone osteosarcoma 143B fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Darzacq X., Kittur N., Roy S., Shav-Tal Y., Singer R.H., Meier U.T. Cardiac - Interactions involving cardiac related proteins Author states NAP57 accumulated above its nucleolar levels at the sites of NAF1-LacI concentration, indicating that NAF1 also bound to NAP57 in the nucleus. NAF1 is retained in the nucleus through fusion " ... to the lac repressor, Lac1, which binds to lac operator sequences that were stably integrated at a single chromosome locus ...", as stated by the author. Author cites Janicki et al., 2004 PMID:15006351 and Robinett et al., 1996 PMID:8991083. The source of the proteins is: The Lac1-tagged NAF1 i.e. NAF1-Lac1 is human as per author statement. NAP57 is human as it is endogenous to the human U2OS cell line used. meier@aecom.yu.edu Accepted 2013-DEC-10 by ORCHARD J. Cell Biol. (0021-9525) 2006 imex curation gar1_mouse H/ACA ribonucleoprotein complex subunit 1 Nola1 Nucleolar protein family A member 1 snoRNP protein GAR1 Gar1 protein protein mouse Mus musculus Mouse MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGFRGRGH FDD03BBEE258D662 snorna_e3_e3-2_rat small nucleolar RNA, H/ACA box 63 E3 E3-2 snorna small nucleolar rna snoRNA snorna rat Rattus norvegicus (Rat) Rat like EBI-9027461 d3zmp6_rat Nucleolar protein 10 Nop10 LOC100360065 rCG_26998 protein protein rat Rattus norvegicus (Rat) Rat MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL 62E9BCFFB27036FA dkc1_rat H/ACA ribonucleoprotein complex subunit DKC1 Dkc1 Nap57 Dyskerin Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 Nucleolar protein family A member 4 snoRNP protein DKC1 protein protein rat Rattus norvegicus (Rat) Rat MADAEAAMTFPKKHKKKKERKPLPEADVAEIQHAEDFLIKPESKAAQLDTSQWPLLLKNFDRLNVRTTHYTPIPCGSNPLKREIGEYVRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGVVRLHNAIEGTAQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESRVVEYDPERRLGVFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVVGERDHMVTMHDVLDAQYLYDHHRDESYLRRVVFPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGLLRYEDGIEVNQEVVVITTKGEAVCVAIALMTTAVISTCDHGVVAKIKRVIMERDTYPRKWGLGPKASQKKQLIKQGLLDKHGRPTDGTPASWTRDYVDYSDSSKKATAAEATPGPGVTADAASIVKRKRDSDSDADEATPTTTPRVKKEKKKKKEKADGGEEAAEDGDGDATRKKKKKKARAAEELSG 038862EBBF2A1E2F b1wc56_rat Ribonucloprotein Nhp2 Nola2 Nola2_predicted rCG_34668 LOC103690013 protein protein rat Rattus norvegicus (Rat) Rat MTKIKVVPEESEAQAEGCSEERTYEELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMVKPHEDYQEAYDKCLEEVQALPTPL 4439D5BD05A0CD59 dkc1_human H/ACA ribonucleoprotein complex subunit DKC1 Dyskerin Nucleolar protein family A member 4 snoRNP protein DKC1 Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 CBF5 homolog DKC1 NOLA4 protein protein human Homo sapiens Human MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE DIP protein O60832 original sequence version: 148 DIP protein O60832 original sequence version: 167 12474DBEEFEB471C naf1_human H/ACA ribonucleoprotein complex non-core subunit NAF1 NAF1 protein protein human Homo sapiens Human MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPVLNAVAAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSSSSSSSCISLPPVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPFPLPVFDMHNFPLRPPPPPPPPPVNMGWATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHFGPYY 5A0C9B635A982A62 dkc1-naf1-3 4 10 unspecified role unspecified role neutral component neutral component fixed cell fixed cell 11 unspecified role unspecified role neutral component neutral component fixed cell fixed cell lac1 fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 2A dkc1-gar1-3 1 9 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 D & E Figure 1 E shows that Increasing the concentration of NAF1 results in reduced binding between GAR1 and NAP57 indicating that NAF1 and GAR1 bind competitively to NAP57. loc100910210-dkc1-1 3 9 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 B Lanes 8 & 12 Presence of NOP10 is essential for these interactions to take place. loc100360065-dkc1-1 3 7 unspecified role unspecified role bait bait 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 C Lanes 6 & 8 Presence of NAP57 is essential for these interactions to take place. loc100910210-dkc1-2 3 8 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 B Lanes 4 & 10 Presence of NOP10 is essential for these interactions to take place. loc100360065-dkc1-2 3 8 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Figure 1 C Lane 4 naf1-snorna-2 2 11 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Figure 5 F dkc1-snorna-2 2 10 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Figure 5 F dkc1-gar1-4 1 8 unspecified role unspecified role bait bait 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 A dkc1-loc100360065 1 8 unspecified role unspecified role bait bait 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 A