IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of Escherichia coli SufA involved in biosynthesis of iron-sulfur clusters: implications for a functional dimer. Crystal structure of Escherichia coli SufA involved in biosynthesis of iron-sulfur clusters: implications for a functional dimer. FEBS Lett. (0014-5793) 2005 imex curation Wada K., Hasegawa Y., Gong Z., Minami Y., Fukuyama K., Takahashi Y. fukuyama@bio.sci.osaka-u.ac.jp 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wada K., Hasegawa Y., Gong Z., Minami Y., Fukuyama K., Takahashi Y. fukuyama@bio.sci.osaka-u.ac.jp Accepted 2013-NOV-25 by PPORRAS FEBS Lett. (0014-5793) 2005 Only protein-protein interactions imex curation sufa_ecoli Protein SufA sufA b1684 JW1674 ydiC protein protein ecoli Escherichia coli (strain K12) MDMHSGTFNPQDFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV D26817F42E4B740B sufa-1 1 2 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 2.7 A R = 0.23; Rwork = 0.23; Rfree = 0.27