UniProt UniProt http://www.uniprot.org The structure of phospholamban pentamer reveals a channel-like architecture in membranes. The structure of phospholamban pentamer reveals a channel-like architecture in membranes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Oxenoid K., Chou J.J. james_chou@hms.harvard.edu 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Oxenoid K., Chou J.J. chou@hms.harvard.edu james_chou@hms.harvard.edu Accepted 2013-APR-26 by ORCHARD 8-May-2012: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Only protein-protein interactions imex curation ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL DIP protein P26678 original sequence version: 151 0766304A76A854D3 pln-1 1 2 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3 NMR structure, meaning no resolution and no R-factors