UniProt UniProt http://www.uniprot.org SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library in vitro In vitro pull down pull down autoradiography autoradiography Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion. Oncogene (0950-9232) 2004 mimix curation Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip weight silver stain molecular weight estimation by silver staining weight silver stain Yordy J.S., Li R., Sementchenko V.I., Pei H., Muise-Helmericks R.C., Watson D.K. watsondk@musc.edu Accepted 2013-JUL-08 by MGT 02-Aug-2013: Contacted by IntAct-Help. human fetal brain cDNA library Oncogene (0950-9232) 2004 mimix curation I have kept P23497-2 since I assume it is isoform 2 which is also named SP100 and which size is exactly 480 AA. From the literature authors use SP100 when they talk about isoform 2. daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 sp100_human Nuclear autoantigen Sp-100 Nuclear dot-associated Sp100 protein Speckled 100 kDa SP100 protein protein human Homo sapiens Human MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASSGALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKGKPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK CA55547DE21B2A10 p14921-2 Protein C-ets-1 ETS1 EWSR2 p54 Ets-1 p42 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 6C3313F2DBE3CF88 tydp2_human Tyrosyl-DNA phosphodiesterase 2 TDP2 EAP2 TTRAP 5'-tyrosyl-DNA phosphodiesterase ETS1-associated protein 2 ETS1-associated protein II TRAF and TNF receptor-associated protein Tyrosyl-RNA phosphodiesterase VPg unlinkase AD-022 protein protein human Homo sapiens Human MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDIIL 37892E125DB64410 fli1_human Friend leukemia integration 1 transcription factor FLI1 Proto-oncogene Fli-1 Transcription factor ERGB protein protein human Homo sapiens Human MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAASQYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY 9C2AAEEAF683F3FA p14921-1 Protein C-ets-1 ETS1 EWSR2 p54 Ets-1 p51 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 3B66BCC464B393FB ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE DIP protein P14921 original sequence version: 175 3B66BCC464B393FB p23497-2 Nuclear autoantigen Sp-100 SP100 SP100 Nuclear dot-associated Sp100 protein Speckled 100 kDa SP100A protein protein human Homo sapiens Human MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASSGALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGKED Major isoform. 10351A33BF3A4C12 ets1-daxx 3 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association fig 1a and materials and methods ets1-sp100 1 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association fig 1b sp100-ets1-3 2 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association fig 1c sp100-ets1-2 4 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association fig 1d ets1-sp100-1 6 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association fig 1e ets1-sp100-4 5 14 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 2 ets1-sp100-5 3 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association fig 1a and materials and methods ets1-tydp2 3 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association fig 1a and materials and methods