UniProt UniProt http://www.uniprot.org Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS fetal brain Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS kidney Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined McDonald E.R., El-Deiry W.S. Not possible to ascertain experimental roles. For the positive control the origin of the constructs is unknown. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western McDonald E.R., El-Deiry W.S. CASP constructs were described in PMID:9228018 and correspond in term of name/amino-acid positions to human isoforms. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu 13-Jan-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence McDonald E.R., El-Deiry W.S. wafik@mail.med.upenn.edu Accepted 2013-DEC-17 by PPORRAS Hela cells Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 mimix curation casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F rnf34_human E3 ubiquitin-protein ligase RNF34 RNF34 RING finger protein 34 RING finger protein RIFF FYVE-RING finger protein Momo Human RING finger homologous to inhibitor of apoptosis protein Caspases-8 and -10-associated RING finger protein 1 Caspase regulator CARP1 RING-type E3 ubiquitin transferase RNF34 protein protein human Homo sapiens Human MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS C044B83BD8591FFA phosphatidylinositol 5-phosphate phosphatidylinositol 5-phosphate PI(5)P PtdIns5P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hgs_human Hepatocyte growth factor-regulated tyrosine kinase substrate Protein pp110 Hrs HGS HRS protein protein human Homo sapiens Human MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD DIP protein O14964 original sequence version: 96 DIP protein O14964 original sequence version: 47 DIP protein O14964 original sequence version: 88 DIP protein O14964-1 original sequence version: 88 DIP protein O14964 original sequence version: 98 DD64167A19DCF030 phosphatidylinositol 4-phosphates phosphatidylinositol 4-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphatidylinositol-3-phosphate phosphatidylinositol 3-phosphate phosphatidylinositol 3-phosphates PI(3)P PtdIns3P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) c8ap2_human CASP8-associated protein 2 CASP8AP2 FLASH KIAA1315 RIP25 FLICE-associated huge protein protein protein human Homo sapiens Human MAADDDNGDGTSLFDVFSASPLKNNDEGSLDIYAGLDSAVSDSASKSCVPSRNCLDLYEEILTEEGTAKEATYNDLQVEYGKCQLQMKELMKKFKEIQTQNFSLINENQSLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTVKTKDLKSRSPHLDDCSKTDHRAKSDVSKDVHHSTSLPNLEKEGKPHSDKRSTSHLPTSVEKHCTNGVWSRSHYQVGEGSSNEDSRRGRKDIRHSQFNRGTERVRKDLSTGCGDGEPRILEASQRLQGHPEKYGKGEPKTESKSSKFKSNSDSDYKGERINSSWEKETPGERSHSRVDSQSDKKLERQSERSQNINRKEVKSQDKEERKVDQKPKSVVKDQDHWRRSERASLPHSKNEITFSHNSSKYHLEERRGWEDCKRDKSVNSHSFQDGRCPSSLSNSRTHKNIDSKEVDAMHQWENTPLKAERHRTEDKRKREQESKEENRHIRNEKRVPTEHLQKTNKETKKTTTDLKKQNEPKTDKGEVLDNGVSEGADNKELAMKAESGPNETKNKDLKLSFMKKLNLTLSPAKKQPVSQDNQHKITDIPKSSGVCDSESSMQVKTVAYVPSISEHILGEAAVSEHTMGETKSTLLEPKVALLAVTEPRIGISETNKEDENSLLVRSVDNTMHCEEPICGTETSFPSPMEIQQTESLFPSTGMKQTINNGRAAAPVVMDVLQTDVSQNFGLELDTKRNDNSDYCGISEGMEMKVALSTTVSETTESILQPSIEEADILPIMLSEDNNPKFEPSVIVTPLVESKSCHLEPCLPKETLDSSLQQTELMDHRMATGETNSVYHDDDNSVLSIDLNHLRPIPEAISPLNSPVRPVAKVLRNESPPQVPVYNNSHKDVFLPNSAHSTSKSQSDLNKENQKPIYKSDKCTEADTCKNSPLDELEEGEIRSDSETSKPQESFEKNSKRRVSADVRKSKTIPRRGKSTVCLDKDSRKTHVRIHQTNNKWNKRPDKSSRSSKTEKKDKVMSTSSLEKIVPIIAVPSSEQEIMHMLRMIRKHVRKNYMKFKAKFSLIQFHRIIESAILSFTSLIKHLNLHKISKSVTTLQKNLCDIIESKLKQVKKNGIVDRLFEQQLPDMKKKLWKFVDDQLDYLFAKLKKILVCDSKSFGRDSDEGKLEKTSKQNAQYSNSQKRSVDNSNRELLKEKLSKSEDPVHYKSLVGCKKSEENYQDQNNSSINTVKHDIKKNFNICFDNIKNSQSEERSLEVHCPSTPKSEKNEGSSIEDAQTSQHATLKPERSFEILTEQQASSLTFNLVSDAQMGEIFKSLLQGSDLLDSSVNCTEKSEWELKTPEKQLLETLKCESIPACTTEELVSGVASPCPKMISDDNWSLLSSEKGPSLSSGLSLPVHPDVLDESCMFEVSTNLPLSKDNVCSVEKSKPCVSSILLEDLAVSLTVPSPLKSDGHLSFLKPDMSSSSTPEEVISAHFSEDALLEEEDASEQDIHLALESDNSSSKSSCSSSWTSRSVAPGFQYHPNLPMHAVIMEKSNDHFIVKIRRATPSTSSGLKQSMMPDELLTSLPRHGKEADEGPEKEYISCQNTVFKSVEELENSNKNVDGSKSTHEEQSSMIQTQVPDIYEFLKDASDKMGHSDEVADECFKLHQVWETKVPESIEELPSMEEISHSVGEHLPNTYVDLTKDPVTETKNLGEFIEVTVLHIDQLGCSGGNLNQSAQILDNSLQADTVGAFIDLTQDASSEAKSEGNHPALAVEDLGCGVIQVDEDNCKEEKAQVANRPLKCIVEETYIDLTTESPSSCEVKKDELKSEPGSNCDNSELPGTLHNSHKKRRNISDLNHPHKKQRKETDLTNKEKTKKPTQDSCENTEAHQKKASKKKAPPVTKDPSSLKATPGIKDSSAALATSTSLSAKNVIKKKGEIIILWTRNDDREILLECQKRGPSFKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR DIP protein Q9UKL3 original sequence version: 101 AF2B1A7798C19E39 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 caspa_human Caspase-10 ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 CASP10 MCH4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS 840348AE602B8243 rffl_human E3 ubiquitin-protein ligase rififylin RFFL RNF189 RNF34L RING finger and FYVE-like domain-containing protein 1 FYVE-RING finger protein Sakura Caspases-8 and -10-associated RING finger protein 2 Caspase regulator CARP2 RING finger protein 189 RING finger protein 34-like RING-type E3 ubiquitin transferase rififylin protein protein human Homo sapiens Human MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHVFRS 9456ED5A0503AFFB casp10-casp8ap2 6 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association table 1 casp10-casp8ap2-1 2 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association table 1 casp10-casp8ap2-2 1 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association table 1 casp10-rnf34 3 15 unspecified role unspecified role experimental role experimental role 8 unspecified role unspecified role experimental role experimental role physical association physical association fig 1A rnf34-casp8 3 8 unspecified role unspecified role experimental role experimental role 7 unspecified role unspecified role experimental role experimental role physical association physical association fig 1A phosphatidylin-rnf34 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association fig 2B phosphatidyl-rnf34-1 5 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association fig 2B phosphatidyl-rnf34-2 5 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 2B phosphatidylinos-hgs 5 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association fig 2B phosphatidylin-hgs-1 5 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association fig 2B phosphatidylin-hgs-2 5 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association fig 2B rnf34-casp8-1 4 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait Q969K3:p.His342Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Wed May 02 19:24:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his342ala' Tue Jun 30 18:37:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His342Ala' physical association physical association fig S9 rffl-casp8 4 16 unspecified role unspecified role bait bait Q8WZ73:p.His333Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Wed May 02 18:23:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his333ala' Tue Jun 30 17:01:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His333Ala' 7 unspecified role unspecified role prey prey physical association physical association fig 3D casp8-rnf34-1 4 8 unspecified role unspecified role prey prey Q969K3:p.His342Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Wed May 02 15:01:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his342ala' Tue Jun 30 19:50:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His342Ala' 7 unspecified role unspecified role bait bait physical association physical association fig 3D