UniProt UniProt http://www.uniprot.org S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. J. Biol. Chem. (0021-9258) 2004 mimix curation Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp 22-Nov-2013: Contacted by IntAct-Help. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp Accepted 2013-NOV-19 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2004 mimix curation S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. J. Biol. Chem. (0021-9258) 2004 mimix curation Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp 22-Nov-2013: Contacted by IntAct-Help. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp Accepted 2013-NOV-19 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2004 mimix curation S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. J. Biol. Chem. (0021-9258) 2004 mimix curation Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp 22-Nov-2013: Contacted by IntAct-Help. bovin-brain Bos taurus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp Accepted 2013-NOV-19 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2004 mimix curation S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. S100A1 is a novel molecular chaperone and a member of the Hsp70/Hsp90 multichaperone complex. J. Biol. Chem. (0021-9258) 2004 mimix curation Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp 22-Nov-2013: Contacted by IntAct-Help. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okada M., Hatakeyama T., Itoh H., Tokuta N., Tokumitsu H., Kobayashi R. Interactions involving purified S100A2 and S100A6 omitted as species origin cannot be established. Authors have been contacted but did not reply. ryoji@kms.ac.jp Accepted 2013-NOV-19 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2004 mimix curation s10a1_rat Protein S100-A1 S100a1 S-100 protein alpha chain S-100 protein subunit alpha S100 calcium-binding protein A1 protein protein rat Rattus norvegicus (Rat) Rat MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS 7B9C0A6C1C4FCCE0 hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD 78F513118C96DE66 hs71a_bovin Heat shock 70 kDa protein 1A HSPA1A HSP70-1 Heat shock 70 kDa protein 1 protein protein bovin Bos taurus (Bovine) Bovine MAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTIEEVD 6FAC1F30540E80F9 fkbp4_human Peptidyl-prolyl cis-trans isomerase FKBP4 FK506-binding protein 4 HSP-binding immunophilin Rotamase 52 kDa FK506-binding protein FKBP59 Immunophilin FKBP52 FKBP4 FKBP52 51 kDa FK506-binding protein 59 kDa immunophilin protein protein human Homo sapiens Human MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA DIP protein Q02790 original sequence version: 130 DIP protein Q02790 original sequence version: 128 DIP protein Q02790 original sequence version: 144 6A498105418D9435 ppid_bovin Peptidyl-prolyl cis-trans isomerase D PPID CYPD 40 kDa peptidyl-prolyl cis-trans isomerase Cyclophilin-40 Cyclophilin-related protein Estrogen receptor-binding cyclophilin Rotamase D protein protein bovin Bos taurus (Bovine) Bovine MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAYAKMFA F278FDE1B9494241 s10a1_bovin Protein S100-A1 S100A1 S-100 protein alpha chain S-100 protein subunit alpha S100 calcium-binding protein A1 protein protein bovin Bos taurus (Bovine) Bovine MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS AD5E400DB85025D2 hs90a_bovin Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPCA protein protein bovin Bos taurus (Bovine) Bovine MPEETQAQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPLEGDDDTSRMEEVD B8D9EB475B613DBE hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD fkbp4_bovin Peptidyl-prolyl cis-trans isomerase FKBP4 FKBP4 52 kDa FK506-binding protein FK506-binding protein 4 HSP-binding immunophilin Immunophilin FKBP52 Rotamase protein protein bovin Bos taurus (Bovine) Bovine MTAEETKAAESGAQSAPLRLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDRFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGLAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYAKPNEGALVEVALEGYFKDQVFDRRELRFEVGEGESMDLPCGLEKAIQRMEKGEHSIVYLKPRYAFGSAGKEKFQIPPNAELKYEIHLKSFEKAKESWEMSSEEKLEQSTIVKERGTVYFKEGKYKQAVLQYKKIVSWLEYESSFSDEDAEKAQALRLASHLNLAMCHLKLQAFSAAIENCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLVVCQQRIRKQLEKEKKLYANMFERLAEEETKAKATVAAGDQPADAEMRDEPKNDVAGGQPQVEAEA 2A0A25B737BC9A7B hsp90aa1-s100a1 1 12 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction 1 and 2 hspa1a-s100a1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait direct interaction direct interaction 1 and 2 fkbp4-s100a1 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait direct interaction direct interaction 1 and 2 ppid-s100a1 1 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction 1 and 2 hsp90aa1-s100a1-1 4 12 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction 3A and B s100a1-hsp90aa1 4 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey direct interaction direct interaction 3F and G hspa1a-s100a1-1 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait direct interaction direct interaction 3C s100a1-hspa1a 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey direct interaction direct interaction 3H fkbp4-s100a1-1 4 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction 3D s100a1-fkbp4 4 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 3I ppid-s100a1-1 4 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait direct interaction direct interaction 3E s100a1-ppid 4 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 3J s100a1-hsp90aa1-1 2 12 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 4A and B s100a1-hspa1a-1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 4C s100a1-fkbp4-1 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 4D s100a1-ppid-1 2 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction 4E ppid-s100a1-2 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5A hsp90aa1-s100a1-2 3 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 5B and C hspa1a-s100a1-2 3 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 5D fkbp4-s100a1-2 3 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 5E s100a1-hsp90aa1-2 3 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 5F and G s100a1-fkbp4-2 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 5H, I and J