mbinfo MBInfo http://www.mechanobio.info/ Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. J. Cell. Sci. (0021-9533) 2002 imex curation Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2002 Only protein-protein interactions imex curation Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. J. Cell. Sci. (0021-9533) 2002 imex curation Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2002 Only protein-protein interactions imex curation Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. Assembly of the PINCH-ILK-CH-ILKBP complex precedes and is essential for localization of each component to cell-matrix adhesion sites. J. Cell. Sci. (0021-9533) 2002 imex curation Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-kidney Human kidney kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Y., Chen K., Tu Y., Velyvis A., Yang Y., Qin J., Wu C. Host organism: Human mesangial cells. Co-immunoprecipitation experiments involving GFP-ILK and FLAG-ILK (Fig. 2B, 2C, 3B, 3C, 4B, 4C, 6D, 6E, 6F, 7B, 7C) could not be curated since the source of the ILK proteins could not be identified. carywu@pitt.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell. Sci. (0021-9533) 2002 Only protein-protein interactions imex curation lims1_human LIM and senescent cell antigen-like-containing domain protein 1 LIMS1 Particularly interesting new Cys-His protein 1 Renal carcinoma antigen NY-REN-48 PINCH PINCH1 protein protein human Homo sapiens Human MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK DIP protein P48059 original sequence version: 110 E665FEB11D849CAE ilk_mouse Integrin-linked protein kinase 59 kDa serine/threonine-protein kinase Beta-integrin-linked kinase ILK-1 ILK-2 ILK1 ILK2 p59ILK Ilk protein protein mouse Mus musculus Mouse MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein O55222 original sequence version: 112 F41960CF8EC503A7 parva_mouse Alpha-parvin Parva Actp Actopaxin MNCb-0301 protein protein mouse Mus musculus Mouse MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE DIP protein Q9EPC1 original sequence version: 87 1251F2586A1ACBC6 ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 lims1_mouse LIM and senescent cell antigen-like-containing domain protein 1 Lims1 Pinch1 Particularly interesting new Cys-His protein 1 protein protein mouse Mus musculus Mouse MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVSCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLSETLGRK DIP protein Q99JW4 original sequence version: 82 E665FEA59B5FFDFE parva_human Alpha-parvin Calponin-like integrin-linked kinase-binding protein CH-ILKBP Matrix-remodeling-associated protein 2 Actopaxin PARVA MXRA2 protein protein human Homo sapiens Human MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE DIP protein Q9NVD7 original sequence version: null F48BB5B1E83F8CEF lims1-ilk-2 1 4 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P48059:p.Gln40Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 20:00:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln40ala' Tue Jun 30 17:35:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln40Ala' 5 unspecified role unspecified role prey prey physical association physical association Fig 1 C. parva-ilk 2 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig 5A, 5B, 5C. ILK, PINCH and CH-ILKBP formed a ternary complex in suspended cells, in cells spread on fibronectin for a short period of time (for 0.5-1 hr) and in well spread cells (for 20 hrs). parva-ilk-2 3 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Fig 6A, 6B, 6C. Inhibition of protein kinase C significantly reduced the amount of ILK ( Fig. 6B) and PINCH ( Fig. 6C) that were in complex with CH-ILKBP. Calphostin C, a specific protein kinase C inhibitor