UniProt UniProt http://www.uniprot.org The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. Hum. Mol. Genet. (0964-6906) 2002 imex curation Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-y7 Homo sapiens Y7 retinoblastoma cells y7 Y7 retinoblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Accepted 2013-MAY-24 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. Hum. Mol. Genet. (0964-6906) 2002 imex curation Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Accepted 2013-MAY-24 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. Hum. Mol. Genet. (0964-6906) 2002 imex curation Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Accepted 2013-MAY-24 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. Hum. Mol. Genet. (0964-6906) 2002 imex curation Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_6 African green monkey kidney cell line Grivet cos_6 African green monkey kidney cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Accepted 2013-MAY-24 by PPORRAS 17-Jun-2013: Contacted by IntAct-Help. Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation aipl1_human Aryl-hydrocarbon-interacting protein-like 1 AIPL1 AIPL2 protein protein human Homo sapiens Human MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLGRYEEASSKYQEAIICLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH 47F681A1DC91A82D nub1_human NEDD8 ultimate buster 1 NUB1 NYREN18 Negative regulator of ubiquitin-like proteins 1 Renal carcinoma antigen NY-REN-18 protein protein human Homo sapiens Human MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVIEEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAASGNLDEALKILLSNPQMWWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKKN D70FD6B21F4CD42E aipl1_bovin Aryl-hydrocarbon-interacting protein-like 1 AIPL1 protein protein bovin Bos taurus (Bovine) Bovine MDATLLLNVEGIKKTILHGGTGDLPNFITGARVTFHFRTMKCDEERTVIDDSKQVGHPMHIIIGNMFKLEVWEILLTSMRVSEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLIFIIELLQVEAPSQYQRETWNLNNQEKMQAVPILHGEGNRLFKLGRYEEASNKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKAVQRELRLLENRLEEKREEERLRCRNMLG B2B5E7ACF5E0A72A nub1_bovin NEDD8 ultimate buster 1 NUB1 Negative regulator of ubiquitin-like proteins 1 protein protein bovin Bos taurus (Bovine) Bovine LGLRACDGNVDHAAVHIANRREELDQIKKEEREKKKRRLENINHLKGMGYSMRAARQALHQAAGNLEEALKILLHNPQLWWLNDSAPESNNRQQSPSQEKIDQLVYMGFDAVAAKAALRVFRDNVQLAAQTLVHNGGRLPPDLQLSAEDSSSTPSTSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENIKSAAKKN B417FBD4CC269FD1 nub1_chlae_protein Green monkey NUB1 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to human NUB1 UniProt Ac Q9Y5A7 aipl1-nub1 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association no figure aipl1-nub1-1 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1 nub1-aipl1 3 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9NZN9:p.Arg53Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R W Wed May 02 18:11:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg53trp' Tue Jun 30 16:59:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg53Trp' Q9NZN9:p.Gly262Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G S Wed May 02 16:03:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly262ser' Tue Jun 30 17:50:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly262Ser' Q9NZN9:p.Met79Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain M T Wed May 02 20:32:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met79thr' Tue Jun 30 16:28:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met79Thr' Q9NZN9:p.Val96Ile mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V I Wed May 02 17:32:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val96ile' Tue Jun 30 18:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val96Ile' region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9NZN9:p.Arg302Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R L Wed May 02 19:31:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg302leu' Tue Jun 30 17:10:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg302Leu' region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A trp278x mutation inducing a premature stop codon was used. 6 unspecified role unspecified role bait bait physical association physical association 2 aipl1-nub1_chlae_pro 4 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 aipl1-nub1-2 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 4