IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. J. Biol. Chem. (0021-9258) 2002 imex curation Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. J. Biol. Chem. (0021-9258) 2002 imex curation Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. J. Biol. Chem. (0021-9258) 2002 imex curation Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro dsc differential scanning calorimetry dsc predetermined predetermined participant predetermined Muller Y.A., Heiring C., Misselwitz R., Welfle K., Welfle H. y.muller@sussex.ac.uk Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation vegfa_human Vascular endothelial growth factor A Vascular permeability factor VEGFA VEGF protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein P15692 original sequence version: 190 DIP protein P15692 original sequence version: 150 FB49F364446F4D01 vegfa-1 2 4 unspecified role unspecified role neutral component neutral component P15692:p.[Cys77Ala;Cys86Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:00:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys77ala,cys86ala' Tue Jun 30 19:43:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys77Ala;Cys86Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.s 1b, 3, Tables II & III R = 0.2; Rwork = 0.2; Rfree = 0.25 2.1 A vegfa-2 2 4 unspecified role unspecified role neutral component neutral component P15692:p.[Cys83Ala;Cys128Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:35:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ala,cys128ala' Tue Jun 30 19:20:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Ala;Cys128Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.s 1b, 3, Tables II & III R = 0.24; Rwork = 0.24; Rfree = 0.29 2.5 A vegfa-3 2 4 unspecified role unspecified role neutral component neutral component P15692:p.[Cys87Ala;Cys130Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 11:08:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys130ala,cys87ala' Wed May 02 17:32:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys87ala,cys130ala' Tue Jun 30 19:36:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys87Ala;Cys130Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.s 1b, 3, Tables II & III R = 0.17; Rwork = 0.17; Rfree = 0.2 1.32 A vegfa-4 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a, Table I vegfa-2 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P15692:p.[Cys83Ala;Cys128Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:59:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ala,cys128ala' Tue Jun 30 17:18:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Ala;Cys128Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a, Table I vegfa-3 1 4 unspecified role unspecified role neutral component neutral component P15692:p.[Cys87Ala;Cys130Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 10:57:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys130ala,cys87ala' Wed May 02 20:24:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys87ala,cys130ala' Tue Jun 30 19:14:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys87Ala;Cys130Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a, Table I vegfa-2 3 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P15692:p.[Cys83Ala;Cys128Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:13:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ala,cys128ala' Tue Jun 30 19:35:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys83Ala;Cys128Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2c, Table I vegfa-3 3 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P15692:p.[Cys87Ala;Cys130Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:50:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys87ala,cys130ala' Tue Jun 30 17:47:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys87Ala;Cys130Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2c, Table I vegfa-4 3 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.s 2b, 2c, Table I