UniProt UniProt http://www.uniprot.org Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding. Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding. BMC Genomics 2001 imex curation Dupressoir A., Morel A.P., Barbot W., Loireau M.P., Corbo L., Heidmann T. heidmann@igr.fr 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dupressoir A., Morel A.P., Barbot W., Loireau M.P., Corbo L., Heidmann T. heidmann@igr.fr Accepted 2013-MAR-04 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. BMC Genomics 2001 Only protein-protein interactions imex curation Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding. Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding. BMC Genomics 2001 imex curation Dupressoir A., Morel A.P., Barbot W., Loireau M.P., Corbo L., Heidmann T. heidmann@igr.fr 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dupressoir A., Morel A.P., Barbot W., Loireau M.P., Corbo L., Heidmann T. heidmann@igr.fr Accepted 2013-MAR-04 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. BMC Genomics 2001 Only protein-protein interactions imex curation cnot6_human CCR4-NOT transcription complex subunit 6 CNOT6 CCR4 KIAA1194 Carbon catabolite repressor protein 4 homolog CCR4 carbon catabolite repression 4-like Cytoplasmic deadenylase CCR4a protein protein human Homo sapiens Human MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLELLLPFLPQVNGIHLPGRR DA9FF7A059BFB583 cnot7_human CCR4-NOT transcription complex subunit 7 CNOT7 CAF1 CCR4-associated factor 1 BTG1-binding factor 1 Caf1a protein protein human Homo sapiens Human MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS DIP protein Q9UIV1 original sequence version: 95 2AF23ED27E06EFDB cnot8_human CCR4-NOT transcription complex subunit 8 CNOT8 CALIF POP2 CCR4-associated factor 8 CAF1-like protein CAF2 Caf1b protein protein human Homo sapiens Human MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ 81027A966E51AFDB cnot6-cnot7 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range physical association physical association 4B cnot6-cnot8 1 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range 5 unspecified role unspecified role prey prey physical association physical association 4B cnot6-cnot7-3 2 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 3 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5