UniProt UniProt http://www.uniprot.org RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. Nucleic Acids Res. (0305-1048) 2000 mimix curation Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca 10-Mar-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. Did not report all possible interactions since some proteins might have transactivation activity and negative controls are not provided for instance for RPA3. mdaj@musica.mcgill.ca Accepted 2014-FEB-14 by PPORRAS Nucleic Acids Res. (0305-1048) 2000 mimix curation RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. Nucleic Acids Res. (0305-1048) 2000 mimix curation Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca 10-Mar-2014: Contacted by IntAct-Help. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Accepted 2014-FEB-14 by PPORRAS Nucleic Acids Res. (0305-1048) 2000 mimix curation RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. Nucleic Acids Res. (0305-1048) 2000 mimix curation Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca 10-Mar-2014: Contacted by IntAct-Help. in vitro In vitro pull down pull down autoradiography autoradiography Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. All constructs are described in MandM or text and are of human origin mdaj@musica.mcgill.ca Accepted 2014-FEB-14 by PPORRAS Nucleic Acids Res. (0305-1048) 2000 mimix curation RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. Nucleic Acids Res. (0305-1048) 2000 mimix curation Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca 10-Mar-2014: Contacted by IntAct-Help. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Accepted 2014-FEB-14 by PPORRAS Nucleic Acids Res. (0305-1048) 2000 mimix curation RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. Nucleic Acids Res. (0305-1048) 2000 mimix curation Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca 10-Mar-2014: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Accepted 2014-FEB-14 by PPORRAS Human osteosarcoma Nucleic Acids Res. (0305-1048) 2000 mimix curation rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 srtd3_human SERTA domain-containing protein 3 Replication protein-binding trans-activator SERTAD3 RBT1 protein protein human Homo sapiens Human MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAALRLAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGSWEWNELDHIMEIILGS 9C54AFA126F17AF1 xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM DIP protein P23025 original sequence version: 75 DIP protein P23025 original sequence version: 116 F89F735219A8494B ung_human Uracil-DNA glycosylase UNG DGU UNG15 UNG1 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL A4B27E6198AFE9C0 rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD DIP protein P35244 original sequence version: 96 3FD99851959FB498 rpa2-sertad3 5 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association results text rpa2-sertad3-1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association table 1 and fig 6 sertad3-rpa2 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association fig 2 rpa3-rpa2 3 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association fig 2 sertad3-rpa2-1 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association fig 3 rpa2-sertad3-3 2 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 5 rpa3-rpa2-1 1 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association table 1 rpa2-xpa 1 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association table 1 and fig 6 rpa2-ung 1 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association table 1 and fig 6 ung-rpa2 1 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association table 1 and fig 6 rpa2-rpa3-3 1 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association table 1