IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. bboyle@amgen.com 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. bboyle@amgen.com Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Primary mouse osteoclast precursor cells purified by FITC-labeled osteoprotegerin ligand (OPGL) sorting. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. bboyle@amgen.com 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-osteoclast Mouse osteoclast osteoclast Osteoclast crosslink cross-linking study crosslink autoradiography autoradiography Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. After cross-linking with 1000 micromolar disuccinimidyl tartrate cell lysates were immunoprecipitated with anti-RANK/Tnfrsf11a antibody. bboyle@amgen.com Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Tumor necrosis factor receptor family member RANK mediates osteoclast differentiation and activation induced by osteoprotegerin ligand. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. bboyle@amgen.com 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293a Homo sapiens hek293a hek293a anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hsu H., Lacey D.L., Dunstan C.R., Solovyev I., Colombero A., Timms E., Tan H.L., Elliott G., Kelley M.J., Sarosi I., Wang L., Xia X.Z., Elliott R., Chiu L., Black T., Scully S., Capparelli C., Morony S., Shimamoto G., Bass M.B., Boyle W.J. bboyle@amgen.com Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation tnf11_mouse Tumor necrosis factor ligand superfamily member 11 Tnfsf11 Opgl Rankl Trance Osteoclast differentiation factor Osteoprotegerin ligand Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine protein protein mouse Mus musculus Mouse MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID 8AF3825F92E0A786 traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 tnr11_mouse Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor Tnfrsf11a Rank protein protein mouse Mus musculus Mouse MAPRARRRRQLPAPLLALCVLLVPLQVTLQVTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSLIVLLLFISVVVVAAIIFGVYYRKGGKALTANLWNWVNDACSSLSGNKESSGDRCAGSHSATSSQQEVCEGILLMTREEKMVPEDGAGVCGPVCAAGGPWAEVRDSRTFTLVSEVETQGDLSRKIPTEDEYTDRPSQPSTGSLLLIQQGSKSIPPFQEPLEVGENDSLSQCFTGTESTVDSEGCDFTEPPSRTDSMPVSPEKHLTKEIEGDSCLPWVVSSNSTDGYTGSGNTPGEDHEPFPGSLKCGPLPQCAYSMGFPSEAAASMAEAGVRPQDRADERGASGSGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGPGSAEPESEPVGRPVQEETLAHRDSFAGTAPRFPDVCATGAGLQEQGAPRQKDGTSRPVQEQGGAQTSLHTQGSGQCAE DIP protein O35305 original sequence version: 82 DIP protein O35305 original sequence version: 91 DIP protein O35305 original sequence version: 102 F8C1872E99511D8E traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL DIP protein P70191 original sequence version: 132 48F64FB83BD587E5 traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV DIP protein P70196 original sequence version: 139 DIP protein P70196 original sequence version: 128 DIP protein P70196 original sequence version: 144 DIP protein P70196 original sequence version: 83 DIP protein P70196 original sequence version: 98 DIP protein P70196 original sequence version: 104 DIP protein P70196 original sequence version: 112 DIP protein P70196 original sequence version: 163 F8389250425E4E2D tnfrsf11a-traf2 3 RANK 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Fig. 4b tnfrsf11a-traf6 3 8 unspecified role unspecified role prey prey RANK 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4b tnfrsf11a-traf2-1 1 RANK 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Fig. 4a tnfrsf11a-traf5 1 RANK 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Fig. 4a tnfrsf11a-traf6-1 1 RANK 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Fig. 4a tnfrsf11a-tnfsf11 2 6 unspecified role unspecified role neutral component neutral component OPGL 4 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1b