mbinfo MBInfo http://www.mechanobio.info/ The essential role of profilin in the assembly of actin for microspike formation. The essential role of profilin in the assembly of actin for microspike formation. EMBO J. (0261-4189) 1998 imex curation Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. The in vivo experiments with PC-12 and swiss3T3 cells (fig 3B) could not be curated since the specific isoform of profilin immunoprecipitated could not be identified. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp Accepted 2012-JUL-30 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 1998 Only protein-protein interactions imex curation The essential role of profilin in the assembly of actin for microspike formation. The essential role of profilin in the assembly of actin for microspike formation. EMBO J. (0261-4189) 1998 imex curation Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. The in vivo experiments with PC-12 and swiss3T3 cells (fig 3B) could not be curated since the specific isoform of profilin immunoprecipitated could not be identified. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp Accepted 2012-JUL-30 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 1998 Only protein-protein interactions imex curation The essential role of profilin in the assembly of actin for microspike formation. The essential role of profilin in the assembly of actin for microspike formation. EMBO J. (0261-4189) 1998 imex curation Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. The in vivo experiments with PC-12 and swiss3T3 cells (fig 3B) could not be curated since the specific isoform of profilin immunoprecipitated could not be identified. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp Accepted 2012-JUL-30 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 1998 Only protein-protein interactions imex curation The essential role of profilin in the assembly of actin for microspike formation. The essential role of profilin in the assembly of actin for microspike formation. EMBO J. (0261-4189) 1998 imex curation Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. The in vivo experiments with PC-12 and swiss3T3 cells (fig 3B) could not be curated since the specific isoform of profilin immunoprecipitated could not be identified. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Suetsugu S., Miki H., Takenawa T. Interactions involving Ash/Grb2 (Fig 5A) could not be curated since the organism source of the protein could not be identified from the paper or traced from references. Interaction detection method: GST pull down. The source of Profilin I and II specified by the author. The source of N-WASP (endogenous) inferred from the cells (3Y1, rat fibroblasts) used (Fig 1B) or traced from references (recombinant N-WASP, Fig 4A). takenawa@ims.u-tokyo.ac.jp Accepted 2012-JUL-30 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. EMBO J. (0261-4189) 1998 Only protein-protein interactions imex curation prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY DIP protein P07737 original sequence version: 73 DIP protein P07737 original sequence version: 160 DIP protein P07737 original sequence version: 97 DIP protein P07737 original sequence version: 98 DIP protein P07737 original sequence version: 168 DIP protein P07737 original sequence version: 140 F725119E55A289EB f1n0w1_bovin DIAPH1 protein protein bovin Bos taurus (Bovine) Bovine MEPPGGGLGPGRGTRDKKKGRNPDELPSAGGDGGKSKKFLERFTSIRSKKEKEKPNSAHRNSSAFYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMSLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKRLHDEKEETAGGYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIAVKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFDEQGEEDSYDLKGRLFFFSTDFSEVFQILLNTVKDSKAEQHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIDIEGLIDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMESDFEQKLQDIQGEKDALDSEKQKIATEKQDLEAEVSQLTGEVAKLSKELEDAKKEVASLSAAVTAVAPPSSATVTPAPPLPGPGLPPPPPPLPGGPGLPPPPPPLPGGPGLPPPPPPLPGGPGLPPPPPPLPGGPGLPPPPPPLPGGPGLPPPPPPLPGGPGMLPPPPPFPGGIPLPPPFPGGPGIPPPLPFGVPAAPVLPFGLTPKKLYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENSELFAKLTSTFSAQTKTKKDQEGGEEKKSLQKKKVKELKVLDSKTAQNLSIFLGSFRMPYHEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGAVPRLRPRLNAILFKLQFGEQVENIKPEIVSVTAACEEVRKSENFSSLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDIQNFPAATDEKDKFVEKMTISFLEKRDFVKDAQEQYNKLRMMHSNMEALYKELGEYFLFDPKKLSVEEFFMDLHNFKNMFVQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQGVRKAVCAATSQLVSELTKEDAMTCVPAKMPKSEEVPTILEETTELLGRAS 061997F65108BAB4 f1n214_bovin ENAH protein protein bovin Bos taurus (Bovine) Bovine SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETAQSKVTATQDSTNLRCIFCGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERMERERLERERLERERLEQEQLERERQERERQDRLERERQERERLERLDRERQERERQEQLEREQLEWERERRISNAAPSSDSSLYSAPLPEYASCQPPSAPPPSYAKVISAPVSEATPEYAVVTALPPTSTPPTPPLRHPATRFATSLGSAFHPVLPHYATVPRPLNKNSRPSSPVNTPSPQPPATKPCAWPTPNFSPLPPSPPVMISSPPGKATGPRPVLPVCVSSPVPPMPPSPTAPSGLLDSVPHPVSPPPTSGPAAPPPPPPLPSLAPLSHCGSQASPPPPPSTPLASTPSSKPSVLPSPSAAAPASVETPLNSVLGDSSAPEPGLQAASQPAETPAQQGIVLGPPAPPPPPPLPPGPAQAPAILPPPPGPPPPPPLPSSGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFSGSMSEDNRPLTGLAAAIAGAKLRKVSRMEDASFPSGGNTTGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKNEDSEPVTSKASSTTTPEPIRKPWERTNTMNGSKSPVISRPKSAPSSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA 6054604B66275B21 prof1_bovin Profilin-1 PFN1 Profilin I protein protein bovin Bos taurus (Bovine) Bovine MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY DIP protein P02584 original sequence version: 114 E56BFBB5BBB016E3 vasp_bovin Vasodilator-stimulated phosphoprotein VASP protein protein bovin Bos taurus (Bovine) Bovine MSETVVCTSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDATQFANGMASALEALEGGGPLPPPPPTAPPTWSAQNGPSPEEMEQQKRQQQSELMERERRASNAGGPPAASAGAPPPPPGPPPPPGPPPPPGLSSSGVSAATQGAGGGPPPAPPLPTAQGPSGGGTGAPSLASAIAGAKLRKVSKQEEASAGPVAPKAESSRSTGGGLMEEMNAMLARRRKATQVGEKPAKDESANQEESDARVPAHSESVRRPWEKNSTTLPRMKSSSSVTTSEAHPATPSSSDESDLERVKQELLEEVRKELQKVKEEIIEAFVQELRKRGAP 991EF24796BAACE0 prof2_human Profilin-2 PFN2 Profilin II protein protein human Homo sapiens Human MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF F43884E1427C9A99 q2nl09_bovin Molybdopterin molybdenumtransferase GPHN protein protein bovin Bos taurus (Bovine) Bovine MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEKFPTFPFCGLQKGATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVHDELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAIAAKKHPFYTSPAVIMAHGEQPIHGLISYSHDATGSAEEPIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKAILHFP 0BA1C7C575754FE4 wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E wasl_bovin Neural Wiskott-Aldrich syndrome protein WASL protein protein bovin Bos taurus (Bovine) Bovine MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQINNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGAPPPPPNRMYPPPLPALPSSAPSGPPPPPPPLSVSGSVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVTDAPESTPPAPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDDEDFEDDDEWED 54B83B48F1CDB3B8 pfn1-wasl-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 association association Fig 1B. Actin, which was also pulled down by GST-profilin, could not be curated since the specific isoform of actin could not be identified. Whereas N-WASP interacted with the H119E-mutant form of profilin I, actin did not. pfn2-wasl-1 2 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 association association Fig 1B. Actin, which was also pulled down by GST-profilin 2, could not be curated since the specific isoform of actin could not be identified. Whereas N-WASP interacted with H119E-mutant form of Profilin 2, actin did not. wasl-pfn1 3 8 unspecified role unspecified role prey prey bovin-spleen Bovien spleen spleen spleen 12 unspecified role unspecified role bait bait spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig 3A. pfn1-wasl-2 2 12 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 4A. pfn2-wasl-2 2 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig 4A. pfn2-wasl-4 4 10 unspecified role unspecified role neutral component neutral component n-terminal region fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range Profilin 2 was labeled with succinimide-fluorescein. ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig 4B. pfn1-wasl-4 4 5 unspecified role unspecified role neutral component neutral component n-terminal region fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range Profilin-1 was labeled with succinimide-fluorescein. ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig 4B, 5D. There was no change in the polarization values of the fluoresceine in the presence of an unlabeled competitor (Ash/Grb2, Fig 5D). pfn1-wasl-5 2 12 unspecified role unspecified role prey prey proline-rich region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 5A. diaph1-enah 1 7 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 9 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 11 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 13 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 6 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Fig 1A. Actin also bound to the wild-type Profilin, but could not be added since the specific isoform of actin was not identified. Except for actin, all other proteins bound to H119E mutant form of profilin.