mbinfo MBInfo http://www.mechanobio.info/ Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Nature (0028-0836) 1998 imex curation Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Accepted 2012-JUN-28 by ORCHARD Nature (0028-0836) 1998 Only protein-protein interactions imex curation Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Nature (0028-0836) 1998 imex curation Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Accepted 2012-JUN-28 by ORCHARD Nature (0028-0836) 1998 Only protein-protein interactions imex curation Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. Nature (0028-0836) 1998 imex curation Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Accepted 2012-JUN-28 by ORCHARD Nature (0028-0836) 1998 Only protein-protein interactions imex curation wasp_human Wiskott-Aldrich syndrome protein WAS IMD2 protein protein human Homo sapiens Human MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD DIP protein P42768 original sequence version: 183 DIP protein P42768 original sequence version: 168 DIP protein P42768 original sequence version: 132 DIP protein P42768 original sequence version: 155 7228428672B7CB78 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E cdc42-wasl-2 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 2a. N-WASP interacts with only GTP-bound Cdc42 and the interaction is abolished when Cdc42 is GDP-bound. cdc42-wasl-3 2 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O08816:p.His208Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H D Wed May 02 18:59:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his208asp' Tue Jun 30 17:16:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His208Asp' 5 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2b. cdc42-was-4 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60953:p.Tyr40Cys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 17:00:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40cys' Tue Jun 30 19:21:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Cys' 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2c. wasl-wasl-1 1 6 unspecified role unspecified role prey prey gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait vca domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 32 direct interaction direct interaction Fig 4c.