UniProt UniProt http://www.uniprot.org Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 imex curation Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. Accepted 2012-NOV-13 by PPORRAS 18-Dec-2012: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 Only protein-protein interactions imex curation Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 imex curation Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom partial id prot seq partial identification of protein sequence partial id prot seq Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. Accepted 2012-NOV-13 by PPORRAS 18-Dec-2012: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 Only protein-protein interactions imex curation Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 imex curation Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. Accepted 2012-NOV-13 by PPORRAS 18-Dec-2012: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1996 Only protein-protein interactions imex curation fa12_human Coagulation factor XII F12 Hageman factor protein protein human Homo sapiens Human MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS F5B861BF635EB480 kng1_human Kininogen-1 KNG1 BDK KNG Alpha-2-thiol proteinase inhibitor Fitzgerald factor High molecular weight kininogen Williams-Fitzgerald-Flaujeac factor protein protein human Homo sapiens Human MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS 3132B4DF2954C24E c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B kng1-c1qbp 2 6 unspecified role unspecified role prey prey human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 5 unspecified role unspecified role bait bait purified purified human Homo sapiens Human physical association physical association 3A and B kng1-c1qbp-1 1 5 unspecified role unspecified role bait bait purified purified human Homo sapiens Human 6 unspecified role unspecified role prey prey human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] physical association physical association 3C kng1-c1qbp-5 3 4 competitor competitor competitor unspecified role unspecified role 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A (1) and 5A zinc f12-c1qbp-5 3 5 competitor competitor competitor unspecified role unspecified role 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 4B (5) and 5B zinc kng1-c1qbp-3 3 6 unspecified role unspecified role prey prey purified purified human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 4A (2) zinc f12-c1qbp-3 3 6 unspecified role unspecified role prey prey purified purified human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 4B (6) zinc