MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Localization of Rab proteins to peroxisomes: a proteomics and immunofluorescence study. Localization of Rab proteins to peroxisomes: a proteomics and immunofluorescence study. FEBS Lett. (0014-5793) 2013 Gronemeyer T., Wiese S., Grinhagens S., Schollenberger L., Satyagraha A., Huber LA., Meyer HE., Warscheid B., Just WW. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation ms participant Identification by mass spectrometry ms participant Gronemeyer T., Wiese S., Grinhagens S., Schollenberger L., Satyagraha A., Huber LA., Meyer HE., Warscheid B., Just WW. FEBS Lett. (0014-5793) 2013 Localization of Rab proteins to peroxisomes: a proteomics and immunofluorescence study. Localization of Rab proteins to peroxisomes: a proteomics and immunofluorescence study. FEBS Lett. (0014-5793) 2013 Gronemeyer T., Wiese S., Grinhagens S., Schollenberger L., Satyagraha A., Huber LA., Meyer HE., Warscheid B., Just WW. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging experimental particp experimental participant identification experimental particp Gronemeyer T., Wiese S., Grinhagens S., Schollenberger L., Satyagraha A., Huber LA., Meyer HE., Warscheid B., Just WW. FEBS Lett. (0014-5793) 2013 rab18_mouse Ras-related protein Rab-18 Rab18 protein protein mouse Mus musculus Mouse MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes mint homomint D1B0F48666999B77 rab14_human Ras-related protein Rab-14 RAB14 protein protein human Homo sapiens Human MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC DIP protein P61106 original sequence version: 114 BC8A8B98FB9944AC rab10_canlf Ras-related protein Rab-10 RAB10 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKVNINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC 5D52B8E8E47D4362 px11a_rat Peroxisomal membrane protein 11A Protein PEX11 homolog alpha Pex11a Pex11 Peroxin-11A Peroxisomal biogenesis factor 11A RnPEX11p 28 kDa peroxisomal integral membrane protein Peroxisomal membrane protein 26 Peroxisomal coatomer receptor protein protein rat Rattus norvegicus (Rat) Rat MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFRLGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQMRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFLLLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQLKLKAR May be involved in peroxisomal proliferation and may regulate peroxisomes division. May mediate binding of coatomer proteins to the peroxisomal membrane mint A4D1951ADE21B04E echp_rat Peroxisomal bifunctional enzyme Ehhadh Mfe1 Multifunctional enzyme 1 Multifunctional protein 1 protein protein rat Rattus norvegicus (Rat) Rat MAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGSKL mint 76ACC709C5F23E86 rab6a_rat Ras-related protein Rab-6A Rab6a Rab6 protein protein rat Rattus norvegicus (Rat) Rat MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVNEGGCSC DD08CC2914668FD4 rab2a_rat Ras-related protein Rab-2A Rab2a Rab2 protein protein rat Rattus norvegicus (Rat) Rat MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTMGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNASHGGNQGGQQAGGGCC B68AAFF894DBE819 rab6a_human Ras-related protein Rab-6A RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC C9A3C2DDBF6C3E9E rab18_rat Ras-related protein Rab-18 Rab18 protein protein rat Rattus norvegicus (Rat) Rat MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSPREESHGGGACGGYCSVL D1A398067A6B9B77 rab10_rat Ras-related protein Rab-10 Rab10 protein protein rat Rattus norvegicus (Rat) Rat MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIEIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDQHANEDVERMLLRNKCDMDHKRVVPKGKGEQIAREHRIRFFETSAKANINIEKAFLTLPEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC EFAF804FD4C3B6A3 rab14_rat Ras-related protein Rab-14 Rab14 protein protein rat Rattus norvegicus (Rat) Rat MATTPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC B435AAC6F562B007 cata_human Catalase CAT protein protein human Homo sapiens Human MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL 7BAA2394D124ED20 cat-rab18 2 Rab18 3 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Catalase 14 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f2 homomint mint We first investigated the intracellular distribution of Rab18, particularly its EGFP-tagged wt, dominant-active (Q67L) and dominant-inactive (S22N) forms in Huh7 cells (Fig. 2). IF images obtained by confocal microscopy suggested colocalization of the expression products with catalase-positive structures. A high degree of co-localization was found with both the dominant-active and -inactive mutants (Fig. 2B, 2C and 2D). In cells stably transfected with the dominant-negative mutant, the total number of peroxisomes was increased by about 50% (Fig. 2E). cat-rab10 2 Catalase 14 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Rab10 5 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5 mint Expression of EGFP-Rab10 in Huh7 cells resulted in peroxisomal targeting of the expression product as revealed by colocalization of the EGFP signal with that of catalase. Both wt, dominant-active and - inactive forms of EGFP-Rab10 localized to peroxisomes (Fig. 5A-C). Compared to wt and the dominant-active protein (Q68L), the dominant-inactive mutant (T23N) in addition to peroxisomes also localized to the Golgi as revealed by the increase in perinuclear staining (Fig. 5C and D). Expressing the three constructs, however, did not affect the total number of cellular peroxisomes (Fig. 5E). cat-rab14 2 Catalase 14 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Rab14 4 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell P61106:p.Gln70Asn mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q N Tue Jul 12 10:19:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:41:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70asn' Tue Jun 30 19:47:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Asn' tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint f7 mint Different to Rab2A, stable expression of Cherry-Rab14 in Huh7 cells clearly resulted in localization of the protein to the peroxisomal compartment (Fig. 7). Comparing the expression patters of wt (Fig. 7A), dominant-active (Q70L, Fig. 7B) and -inactive (S25N, Fig. 7C) Rab14 showed peroxisomal localization predominantly in its dominant-active form. In this case, a nearly complete peroxisomal topology was observed. In contrast, the dominant-inactive Rab14 (S25N) accumulated at intracellular structures that localized closely around the cell nucleus rather than to peroxisomes (Fig. 7C). cat-rab6a 2 Rab6 10 anti tag immunost anti tag immunostaining anti tag immunost experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Catalase 14 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization homomint mint f8 To study its intracellular distribution, HA-tagged wt, dominant-active (Q72L) and - inactive (N126I) Rab6 constructs were transfected into Huh7 cells and cell lines stably expressing the constructs established. All corresponding proteins localized to peroxisomes (Fig. 8). ehhadh-pex11a 1 PEX11alpha 6 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level bifunctional enzyme 7 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rab-2A 9 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rab-14 13 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rab-6A 8 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rab-10 12 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rab-18 11 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f1 mint Using bifunctional protein and Pex11 as markers for the peroxisomal matrix and membrane, respectively, protein abundance profiling [34] identified Rab2, Rab6, Rab10, Rab14, and Rab18 as potential peroxisomal constituents (Fig. 1). Except Rab8 [21], these Rab proteins were also detected in the low-density microsomal region of the gradient, however their maximal concentration was clearly correlated with the peroxisomal fraction.