Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com Defining regulatory and phosphoinositide-binding sites in the human WIPI-1 beta-propeller responsible for autophagosomal membrane localization downstream of mTORC1 inhibition. Defining regulatory and phosphoinositide-binding sites in the human WIPI-1 beta-propeller responsible for autophagosomal membrane localization downstream of mTORC1 inhibition. J Mol Signal 2012 imex curation Gaugel A., Bakula D., Hoffmann A., Proikas-Cezanne T. tassula.proikas-cezanne@uni-tuebingen.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Gaugel A., Bakula D., Hoffmann A., Proikas-Cezanne T. tassula.proikas-cezanne@uni-tuebingen.de upon rapamycin-induced autophagy J Mol Signal 2012 imex curation Molecular Connections Pvt. Ltd. Defining regulatory and phosphoinositide-binding sites in the human WIPI-1 beta-propeller responsible for autophagosomal membrane localization downstream of mTORC1 inhibition. Defining regulatory and phosphoinositide-binding sites in the human WIPI-1 beta-propeller responsible for autophagosomal membrane localization downstream of mTORC1 inhibition. J Mol Signal 2012 imex curation Gaugel A., Bakula D., Hoffmann A., Proikas-Cezanne T. tassula.proikas-cezanne@uni-tuebingen.de 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. Ltd. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy immunostaining immunostaining Gaugel A., Bakula D., Hoffmann A., Proikas-Cezanne T. tassula.proikas-cezanne@uni-tuebingen.de Accepted 2013-DEC-16 by PPORRAS upon rapamycin-induced autophagy J Mol Signal 2012 imex curation Molecular Connections Pvt. Ltd. wipi1_human WD repeat domain phosphoinositide-interacting protein 1 WD40 repeat protein interacting with phosphoinositides of 49 kDa Atg18 protein homolog WIPI1 WIPI49 protein protein human Homo sapiens Human MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS 35B5650990B62E31 atg12_human Ubiquitin-like protein ATG12 Autophagy-related protein 12 ATG12 APG12 APG12L protein protein human Homo sapiens Human MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG DIP protein O94817 original sequence version: 63 DIP protein O94817-1 original sequence version: 102 109258521C2D194F pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) atg12-wipi1-1 2 WIPI-1 3 unspecified role unspecified role neutral component neutral component n-term gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GFP construct details obtained from back reference- PMID-15602573 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 4 unspecified role unspecified role neutral component neutral component colocalization colocalization fig. 4 U2OS cells transiently express GFP-WIPI-1 or GFP-tagged mutant WIPI-1 variants the following mutations on WIPI1 did not nullify the ability to localize at autophagosomal membranes-Asn23, Gln24, Asp25, Glu64, Arg107, Arg110, Arg112, Gly198, Glu224, Phe225, Ser250, Ser335, Gly336 1_phosphatidyl_1d_myo_inositol_3_phosphate _wipi1 1 5 unspecified role unspecified role bait bait WIPI-1 3 unspecified role unspecified role prey prey Q5MNZ9:p.Arg112Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:36:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg112ala' Tue Jun 30 20:00:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg112Ala' n-term gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GFP construct details obtained from back reference- PMID-15602573 Q5MNZ9:p.Arg226_Arg227delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RR AA Thu Jul 07 12:18:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg226_227ala Fri Jul 22 10:53:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg226ala,arg227ala' Wed May 02 20:02:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg226-227ala_ala' Tue Jun 30 15:55:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg226_Arg227delinsAlaAla' Q5MNZ9:p.His185Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H A Wed May 02 16:25:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his185ala' Tue Jun 30 20:14:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His185Ala' Q5MNZ9:p.Ser203Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:17:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser203ala' Tue Jun 30 17:36:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser203Ala' Q5MNZ9:p.Ser205Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:27:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser205ala' Tue Jun 30 19:59:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser205Ala' Q5MNZ9:p.Gly208Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 14:27:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly208ala' Tue Jun 30 16:23:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly208Ala' Q5MNZ9:p.Thr209Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:44:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr209ala' Tue Jun 30 15:49:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr209Ala' Q5MNZ9:p.Arg212Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:05:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg212ala' Tue Jun 30 17:20:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg212Ala' Q5MNZ9:p.Arg226Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:37:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg226ala' Tue Jun 30 19:10:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg226Ala' Q5MNZ9:p.Arg227Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:54:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg227ala' Tue Jun 30 16:34:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Ala' Q5MNZ9:p.Gly228Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:17:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly228ala' Tue Jun 30 15:45:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly228Ala' Q5MNZ9:p.Ser251Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:32:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser251ala' Tue Jun 30 16:26:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser251Ala' Q5MNZ9:p.Thr255Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:51:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr255ala' Tue Jun 30 17:24:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr255Ala' Q5MNZ9:p.His257Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H A Wed May 02 17:03:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his257ala' Tue Jun 30 18:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His257Ala' human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference physical association physical association figs. 6, 7 U2OS cells transiently express GFP-WIPI-1 or GFP-tagged mutant WIPI-1 variants the following mutations on WIPI1 did not nullify the ability to localize at autophagosomal membranes-Asn23, Gln24, Asp25, Glu64, Arg107, Arg110, Arg112, Gly198, Glu224, Phe225, Ser250, Ser335, Gly336 1_phosphatidyl_1d_myo_inositol_3_5_bisphosphate-wipi1 1 6 unspecified role unspecified role bait bait WIPI-1 3 unspecified role unspecified role prey prey n-term gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GFP construct details obtained from back reference- PMID-15602573 Q5MNZ9:p.Arg226_Arg227delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RR AA Thu Jul 07 12:17:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg226_227ala Fri Jul 22 10:56:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg226ala,arg227ala' Wed May 02 18:50:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg226-227ala_ala' Tue Jun 30 17:07:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg226_Arg227delinsAlaAla' human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference physical association physical association figs. 6, 8 U2OS cells transiently express GFP-WIPI-1 or GFP-tagged mutant WIPI-1 variants the following mutations on WIPI1 did not nullify the ability to localize at autophagosomal membranes-Asn23, Gln24, Asp25, Glu64, Arg107, Arg110, Arg112, Gly198, Glu224, Phe225, Ser250, Ser335, Gly336