IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-jeko-1 JEKO-1 Mantle cell lymphoma cell line jeko-1 JEKO-1 Mantle cell lymphoma cell line http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-3006&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. MYC-ON cells:P493-6 cells bear a tetracycline (tet)-repressible MYC construct such that tet withdrawal results in rapid induction of MYC followed by cell proliferation. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. The authors replied (eventually) - so could add Fig 4A. 293T cells were cotransfected with vectors expressing FLAG-tagged full-length specific HDAC3 and/or with full-length MYC. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-ramos Human Caucasian Burkitt's lymphoma ramos Human Caucasian Burkitt's lymphoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-b-cell lymphoma Homo sapiens b-cell lymphoma B-cell lymphoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. High grade lymphoma cells expressing high levels of MYC:- two blastic Mantle Cell Lymphomas, one Burkitts lymphoma and one Burkitts-like lymphoma. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-mino Human Mino Mantle cells - blastic lymphoma cell line mino Human MINO Mantle cell - blastic lymphoma cell line http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-3000&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-jeko-1 JEKO-1 Mantle cell lymphoma cell line jeko-1 JEKO-1 Mantle cell lymphoma cell line http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-3006&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Coordinated Silencing of MYC-Mediated miR-29 by HDAC3 and EZH2 as a Therapeutic Target of Histone Modification in Aggressive B-Cell Lymphomas. Cancer Cell (1535-6108) 2012 imex curation Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. chIPs involving antibodies to H3 have not been included due to lack of antibody target specificity. Figure 4A (using 293T cells) cannot be added as the origin of the FLAG-HDAC3/FLAG_MYC constructs cannot be determined. jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang X., Zhao X., Fiskus W., Lin J., Lwin T., Rao R., Zhang Y., Chan J.C., Fu K., Marquez V.E., Chen-Kiang S., Moscinski L.C., Seto E., Dalton W.S., Wright K.L., Sotomayor E., Bhalla K., Tao J. Cancer - Interactions investigated in the context of cancer Figures S3E/F:- the cell lines given in the image legend do not agree with the cell lines used on the image. The authors confirm the image labelling is correct, rather than the legend. P493-6 cells bear a tetracycline (tet)-repressible MYC construct such that tet withdrawal results in rapid induction of MYC followed by cell proliferation. Results from Figure 3A have not been added as they were not experimentally obtained; they were derived from the database UCSC (http://genome.ucsc.edu/) and ECR(http://ecrbrowser.dcode.org/). The authors confirm that formaldehyde was used as a cross-linker in chIP assays. They also confirm that the FLAG/MYC -HDAC3 constructs used are Human in origin. jianguo.tao@moffitt.org jianguo.tao@moffitt.org,Jianguo.Tao@moffitt.org Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 pri-mir-29a_29b1_regulatory_region Human pri-miR-29a/29b1 Regulatory Region dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P24928 original sequence version: 108 DIP protein P24928 original sequence version: 147 DIP protein P24928 original sequence version: 158 DIP protein P24928 original sequence version: 157 DIP protein P24928 original sequence version: 179 DIP protein P24928 original sequence version: 181 DIP protein P24928 original sequence version: 161 DIP protein P24928 original sequence version: 175 DIP protein P24928-1 original sequence version: 175 DIP protein P24928 original sequence version: 68 DIP protein P24928 original sequence version: 116 28D6FD25693A6472 mir-494 microRNA 494 gene gene human Homo sapiens Human pri-mir-29b2_29c_regulatory_region Human pri-miR-29b2/29c Regulatory Region dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 hdac3-mir_29b2 4 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3B-1 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-2 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 3B-3 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 4 12 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3B-2 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29a-8 4 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3B-4 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29b2-3 7 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3B-1 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29a-9 7 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 3B-4 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 7 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 3B-2 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-3 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 3B-3 Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29b2-8 2 12 unspecified role unspecified role ancillary ancillary 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3C-1 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. hdac3-mir_29a-12 2 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary association association 3C Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. myc-mir_29a-1 2 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 3C-3 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. myc-mir_29b2-1 2 12 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3C-2 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. ezh2-mir_29b2-6 2 12 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3C-5 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. ezh2-mir_29a-9 2 12 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3C-6 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. suz12-mir_29b2-3 2 12 unspecified role unspecified role ancillary ancillary 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 3C-7 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. suz12-mir_29a-5 2 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary association association 3C-8 Both EZH2 and SUZ12 bound to the miR-29 promoters in MYC-on but not in MYC-off P493-6 lymphocytes. suz12-mir_29a-1 4 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3D 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29a-5 4 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 3Di 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-1 4 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 3D 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-2 4 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 3Dii 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29a-6 7 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 3Di-1 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29b2 7 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 3Dii-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-3 7 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3D-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29a-2 7 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3Diii 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. hdac3-mir_29b2-6 5 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3E ezh2-mir_29b2-4 5 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3E suz12-mir_29a-3 5 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3E myc-mir_29b2-1 5 12 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3E hdac3-mir_29a-10 5 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3E myc-mir_29a-4 5 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 3E hdac3-mir_29b2-6 5 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3E ezh2-mir_29a-7 5 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 3E ezh2-mir_29b2-5 6 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. suz12-mir_29a-4 6 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29b2-5 6 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. ezh2-mir_29a-8 6 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association S3B 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. hdac3-mir_29a-11 6 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29b2-1 6 12 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. myc-mir_29a-5 6 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hdac3-mir_29b2-7 6 16 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association S3A Sites S3 of miR-29a/b1 and sites S2 and S3 of miR-29b2/c carry binding sites for both MYC and HDAC3. hist1h4a-mir_29a-3 2 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role ancillary ancillary association association S3D Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. polr2a-mir_29a-5 2 12 unspecified role unspecified role ancillary ancillary 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association S3D Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. suz12-mir_29b2-1 6 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association S3E(F) polr2a-mir_29b2 6 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association S3E-1(F) polr2a-mir_29a-1 4 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S3E-ii(F) 3-Deazaneplanocin A (DZNep), a global histone methylation inhibitor - used as an HDAC and EZH2 inhibitor. Binding is increased in the presence of DZNep. polr2a-mir_29b2-1 4 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association S3E-3(F) 3-Deazaneplanocin A (DZNep), a global histone methylation inhibitor - used as an HDAC and EZH2 inhibitor. Binding is increased in the presence of DZNep. polr2a-mir_29b2-2 7 14 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association S3F(E) 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. Binding is increased in the presence of DZNep. HDAC3 knockdown by shRNA polr2a-mir_29a-2 7 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S3F(E)-2 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. Binding is increased in the presence of DZNep. HDAC3 knockdown by shRNA polr2a-mir_29a-3 7 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S3F(E) HDAC3 knockdown by shRNA polr2a-mir_29b2-3 2 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary association association S3Dii Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. hist1h4a-mir_29b2 2 12 unspecified role unspecified role ancillary ancillary 16 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S3D-2 Enrichment of Ac-H4 and Pol2 was significantly increased and Me3-H3K27 is significantly decreased in MYC-off P493-6 cells. hist1h4a-mir_29a-2 7 17 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey association association S3F(E)-ii HDAC3 knockdown by shRNA suz12-hdac3 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4B hdac3-suz12 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4B myc-hdac3 8 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 4C-1 hdac3-ezh2 8 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 4C-2 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. suz12-ezh2 8 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 4C-3 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. ezh2-hdac3 8 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 4C-4/4D In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. In MYC-ON cells with transfected si-HDAC3 the reaction between SUZ12 and EZH2 was preserved. hdac3-ezh2-1 8 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 4C-5 In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. suz12-ezh2-1 8 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 4C-6/4D In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2. In MYC-ON cells with transfected si-HDAC3 the interaction between SUZ12 and EZH2 was preserved wheras the interaction with SUZ12/ MYC was not. suz12-mir_29b2-2 4 10 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5F 3-Deazaneplanocin A (DZNep) an S-Adenosylhomocysteine Hydrolase inhibitor and histone methyltransferase EZH2 inhibitor. myc-hdac3-1 3 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4A hdac3-ezh2-2 3 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 4A In MYC-OFF cells a weaker interaction is seen between HDAC3, SUZ12 and EZH2.