MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin. Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin. FEBS J. (1742-464X) 2012 Derache C., Epinette C., Roussel A., Gabant G., Cadene M., Korkmaz B., Gauthier F., Kellenberger C. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Derache C., Epinette C., Roussel A., Gabant G., Cadene M., Korkmaz B., Gauthier F., Kellenberger C. FEBS J. (1742-464X) 2012 spi_schgr Greglin protein protein desert locust Schistocerca gregaria Gryllus gregarius SEDDGSASPESQEMSYTELPCPSICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEAGFVYTFVPREMCKATTSLCPMQTKSS mint CFEAA69ABDCC39EF subc_bacli Subtilisin Carlsberg subC apr protein protein bacli Bacillus licheniformis MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYAKGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides mint 38432C04FFA048C1 apr-spi 1 Greglin 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Subtilisin Carlsberg 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint The atomic coordinates and structure factors have been deposited with the RCSB Protein Data Bank under accession number 4GI3 t1 f1 sf6