IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. Cell (0092-8674) 2012 imex curation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Accepted 2013-FEB-20 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. Cell (0092-8674) 2012 imex curation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference scanning electron microscopy scanning electron microscopy sem sem tag visualisation tag visualisation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. MiniSOG (singlet oxygen generator) is a fluorescent 106-residue protein tag with which to visualize proteins by correlated light and EM. Fluorescence photo-oxidation of miniSOG catalyzes the local formation of an electron-dense polymer on the surface of the fusion protein that can be detected by EM. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Accepted 2013-FEB-20 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. Cell (0092-8674) 2012 imex curation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Accepted 2013-FEB-20 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. Cell (0092-8674) 2012 imex curation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Accepted 2013-FEB-20 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. Cell (0092-8674) 2012 imex curation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Accepted 2013-FEB-20 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation nbn_human Nibrin Nijmegen breakage syndrome protein 1 Cell cycle regulatory protein p95 NBN NBS1 NBS P95 protein protein human Homo sapiens Human MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR DIP protein O60934 original sequence version: 65 DIP protein O60934 original sequence version: 84 DIP protein O60934 original sequence version: 96 DIP protein O60934 original sequence version: 131 DIP protein O60934 original sequence version: 133 DIP protein O60934 original sequence version: 128 DIP protein O60934 original sequence version: 99 DIP protein O60934 original sequence version: 85 CD602F09BA73DAB6 e411_ade05 Probable early E4 11 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MIRCLRLKVEGALEQIFTMAGLNIRDLLRDILRRWRDENYLGMVEGAGMFIEEIHPEGFSLYVHLDVRAVCLLEAIVQHLTNAIICSLAVEFDHATGGERVHLIDLHFEVLDNLLE AE4EF38B8F81EE0A e411-e411 5 7 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component P04489:p.Asn82Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 17:10:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn82ala' Tue Jun 30 16:21:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn82Ala' P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:47:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys71ser,asn82ala,cys86ser' Tue Jun 30 19:05:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys71Ser;Asn82Ala;Cys86Ser]' n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 1C, 1E, 3C-F, 4D, Supp Fig. 1C e411-1 1 7 unspecified role unspecified role neutral component neutral component P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:52:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys71ser,asn82ala,cys86ser' Tue Jun 30 17:46:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys71Ser;Asn82Ala;Cys86Ser]' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04489:p.Asn82Ala mutation mutation certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:36:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn82ala' Tue Jun 30 17:33:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn82Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 1A, 1B e411-1 3 7 unspecified role unspecified role neutral component neutral component P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:46:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys71ser,asn82ala,cys86ser' Tue Jun 30 15:54:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys71Ser;Asn82Ala;Cys86Ser]' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 2.05A Rworking = 0.21 Rfree = 0.26 e411-1 2 7 unspecified role unspecified role neutral component neutral component single oxygen generator minisog fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component single oxygen generator minisog fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 5, Supp. Fig. 4B e411-nbn 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6C