mpidb The Microbial Protein Interaction Database Phage Shock Protein C (PspC) of Yersinia enterocolitica Is a Polytopic Membrane Protein with Implications for Regulation of the Psp Stress Response. Phage Shock Protein C (PspC) of Yersinia enterocolitica Is a Polytopic Membrane Protein with Implications for Regulation of the Psp Stress Response. J. Bacteriol. (0021-9193) 2012 imex curation Flores-Kim J., Darwin A.J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Flores-Kim J., Darwin A.J. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Phage Shock Protein C (PspC) of Yersinia enterocolitica Is a Polytopic Membrane Protein with Implications for Regulation of the Psp Stress Response. Phage Shock Protein C (PspC) of Yersinia enterocolitica Is a Polytopic Membrane Protein with Implications for Regulation of the Psp Stress Response. J. Bacteriol. (0021-9193) 2012 imex curation Flores-Kim J., Darwin A.J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Flores-Kim J., Darwin A.J. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q9f4h4_yeren pspA ERS008652_01253 protein protein yeren Yersinia enterocolitica MGIFSRFADIVNANINTLLDKAEDPQKLVRLMIQEMEDTLVEIRSTSARALAEKKQLLRRIDHCESQQQEWQDKAELALRKDKEDLARAALIEKQKVVALIETLTREVATVDETLTRMKHEITELESKLTETRARQQALTLRHQAAASSRDVRRQLDSGKLDEAMARFEQFERRIDHMEAEAETVGIGKQKSLESQFAELKADDEISNQLAALKAKMNSAQ 2BC88B4380D828F0 q9f4h2_yeren pspC protein protein yeren Yersinia enterocolitica MGDMFKNNSFKNDSFKNYSFKNNVLSKKKLYRVPEEGMIKGVCAGLAHYFDIPVRLIRVMVVLSLFFGLFVFTIAAYIVLTFVLEPAPASSFSEHREATPRQLLDQLEYELGAGEQRLRQVERYVTSETFGVQSRFRQL 6D95B2B9A4A89C6C q9f4h3_yeren ERS137941_03600 pspB ERS008652_01252 protein protein yeren Yersinia enterocolitica MSILFLAIPLTIFVLFVAPIWLWLHYSNRQQSGAQLSHQDMQRLSQLTDDARRMRERIQALEEILDAEHPNWRQS 0C9D5DCB7B40005F pspa-pspc-2 2 4 unspecified role unspecified role prey prey Q9F4H2:p.Val125Asp Q9F4H2-125-125 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V D Wed May 02 17:59:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val125asp' Tue Jun 30 19:58:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val125Asp' Q9F4H2:p.Phe130Ser Q9F4H2-130-130 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F S Wed May 02 16:38:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe130ser' Tue Jun 30 16:24:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe130Ser' Q9F4H2:p.Leu118Pro Q9F4H2-118-118 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:46:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu118pro' Tue Jun 30 15:58:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu118Pro' region Q9F4H2-123-139 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q9F4H2:p.Ser127Pro Q9F4H2-127-127 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S P Wed May 02 15:30:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser127pro' Tue Jun 30 19:22:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser127Pro' 3 unspecified role unspecified role bait bait physical association physical association figure 7A, 7B pspc-pspa 1 4 unspecified role unspecified role bait bait Q9F4H2:p.Val125Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V D Wed May 02 15:10:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val125asp' Tue Jun 30 18:23:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val125Asp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association figure 7 pspb-pspc-9 2 4 unspecified role unspecified role prey prey c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3 pspc-pspc-6 2 4 unspecified role unspecified role prey prey n-terminal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3 pspc-pspc-7 2 4 unspecified role unspecified role bait bait c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3