IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. Cell (0092-8674) 2012 imex curation Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. cjl@kist.re.kr 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. cjl@kist.re.kr Accepted 2013-FEB-26 by MGT 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. Cell (0092-8674) 2012 imex curation Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. cjl@kist.re.kr 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. Author cites this interaction from a previously described Y2H screen (PMID:20362547), however this interaction is not described in this paper so has been included here for completeness. cjl@kist.re.kr Accepted 2013-FEB-26 by MGT 01-March-2013: Contacted by IntAct-Help. Human brain cDNA Cell (0092-8674) 2012 Only protein-protein interactions imex curation TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. Cell (0092-8674) 2012 imex curation Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. cjl@kist.re.kr 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. Interaction involving GIRK1 could not be captured as source of construct could not be traced. cjl@kist.re.kr Accepted 2013-FEB-26 by MGT 01-March-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation gbg4_human Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 GNG4 GNGT4 protein protein human Homo sapiens Human MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL 42FAEF4728F83FF5 gbg3_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 Gng3 Gngt3 protein protein mouse Mus musculus Mouse MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL 35CC03965FE69A9D kcnk2_rat Potassium channel subfamily K member 2 Kcnk2 Two pore potassium channel TPKC1 Outward rectifying potassium channel protein TREK-1 Stretch-activated potassium channel TREK-1 TREK-1 K(+) channel subunit Trek Two pore domain potassium channel TREK-1 protein protein rat Rattus norvegicus (Rat) Rat MLASASRERPGYTAGVAAPDLLDPKSAAQNSKPRLSFSAKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQNFIAQHACVNSTELDELIQQIVTAINAGIIPLGNNSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAELAGNHNQELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAAEDIAVIENMK CACDA05BBE95FDBC gbg8_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 Gng8 Gng9 Gngt9 Gamma-9 protein protein mouse Mus musculus Mouse MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCTLL 153206AC7F38EE40 gbg4_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 Gng4 Gngt4 protein protein mouse Mus musculus Mouse MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAASDLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL 42FAEF47311FA195 gbg2_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 Gng2 G gamma-I protein protein mouse Mus musculus Mouse MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL EDB74E4135E7A37A gbg12_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Gng12 protein protein mouse Mus musculus Mouse MSSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTCIIL A4D56F3BD697E7B4 gbg1_mouse Guanine nucleotide-binding protein G(T) subunit gamma-T1 Gngt1 Gng1 Transducin gamma chain protein protein mouse Mus musculus Mouse MPVINIEDLTEKDKLKMEVDQLKKEVTLERMMVSKCCEEVRDYIEERSGEDPLVKGIPEDKNPFKELKGGCVIS 3ABB43EF45CE02F4 gbg7_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Gng7 Gngt7 protein protein mouse Mus musculus Mouse MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL 0F07C667A29ADC07 gbg13_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 Gng13 protein protein mouse Mus musculus Mouse MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKAKCTIL DIP protein Q9JMF3 original sequence version: 63 1FB8D74EB5CE50F5 kcnk2-gng4 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q920B6:p.Ala39Ser mutation mutation certain certain sequence position certain certain certain sequence position certain A S Wed May 02 19:51:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala39ser' Tue Jun 30 16:16:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala39Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3A, 3B, Supp. Fig. 5A, 5B kcnk2-gng4-3 3 4 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C, 3D gng4-kcnk2-3 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q920B6:p.Ala39Ser mutation mutation certain certain sequence position certain certain certain sequence position certain A S Wed May 02 18:46:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala39ser' Tue Jun 30 18:13:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala39Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 5A, 5C gngt1-kcnk2-1 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng2-kcnk2-1 3 9 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng3-kcnk2-1 3 5 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng4-kcnk2-2 3 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng7-kcnk2-1 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng8-kcnk2-1 3 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng12-kcnk2-1 3 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J gng13-kcnk2-1 3 13 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3J