mpidb The Microbial Protein Interaction Database The Structure of the PapD-PapGII Pilin Complex Reveals an Open and Flexible P5 Pocket. The Structure of the PapD-PapGII Pilin Complex Reveals an Open and Flexible P5 Pocket. J. Bacteriol. (0021-9193) 2012 imex curation Ford B., Verger D., Dodson K., Volkan E., Kostakioti M., Elam J., Pinkner J., Waksman G., Hultgren S. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ford B., Verger D., Dodson K., Volkan E., Kostakioti M., Elam J., Pinkner J., Waksman G., Hultgren S. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation papd_ecolx Chaperone protein PapD papD protein protein ecolx Escherichia coli MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK DIP protein P15319 original sequence version: 98 DIP protein P15319 original sequence version: 70 D8AAEA2B346D7268 q1r2w9_ecout papD UTI89_C4892 protein protein ecout Escherichia coli (strain UTI89 / UPEC) MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK D8AAEA2B346D7268 papg2_ecolx Fimbrial adhesin PapGII papGII protein protein ecolx Escherichia coli MKKWFPALLFSLCVSGESSAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGFWAYYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGGCRPSAQSLEIKHGDLSINSANNHYAAQTLSVSCDVPANIRFMLLRNTTPTYSHGKKFSVGLGHGWDSIVSVNGVDTGETTMRWYKAGTQNLTIGSRLYGESSKIQPGVLSGSATLLMILP DF6047C92C3F9BAA q47445_ecolx BWI89_24335 ORF_7 papG papGII BvCmsKSNP073_04101 SAMEA3472056_05214 BK292_27715 BK373_14855 BIQ87_16795 D1912_32270 HNC75_25445 papG-II EA239_22645 BON93_24315 HIE29_005306 HMJ82_28375 HMU06_18350 HNC30_06990 MS7163_03189 protein protein ecolx Escherichia coli MKKWFPALLFSLCVSGESSAWNNIVFYSLGNVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPGFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDAGNLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGGCRPSAQSLEIKHGDLSINSANNHYAAQTLSVSCDVPANIRFMLLRNTTPTYSHGKKFSVGLGHGWDSIVSVNGVDTGETTMRWYKAGTQNLTIGSRLYGESSKIQPGVLSGSATLLMILP 7A0FD2A0347BE3A6 papd-papg 1 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 2.3 A Rworking = 0.23 Rfree = 0.29 papd-q47450 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 13 direct interaction direct interaction Table 2 2.03 A Rworking = 0.18 Rfree = 0.19