mpidb The Microbial Protein Interaction Database Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. J. Bacteriol. (0021-9193) 2012 imex curation Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. J. Bacteriol. (0021-9193) 2012 imex curation Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation crga_myctu Cell division protein CrgA crgA MTCY10H4.11c Rv0011c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH 3D656B59FF629690 cwsa_myctu Cell wall synthesis protein CwsA cwsA Cell wall synthesis and cell shape protein A MTCY10H4.07c Rv0008c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSARSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLWIFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRS 7C17CCD1189707D7 wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN D36113355149CEDC ag84-y008 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 5 y008-ag84 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association figure 5 y011-y011-1 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association figure 1B y008-y011 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association figure 1B y008-y008-1 2 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association figure 1B, 5 y011-y008-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait p67376-- P67376-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 1 y008-y011-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait p71577-- P71577-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 1A