IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein interactomics based on direct molecular fishing on paramagnetic particles: Experimental simulation and SPR validation. Protein interactomics based on direct molecular fishing on paramagnetic particles: Experimental simulation and SPR validation. Proteomics (1615-9853) 2012 imex curation Ershov P., Mezentsev Y., Gnedenko O., Mukha D., Yantsevich A., Britikov V., Kaluzhskiy L., Yablokov E., Molnar A., Ivanov A., Lisitsa A., Gilep A., Usanov S., Archakov A. pavel79@inbox.ru 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ershov P., Mezentsev Y., Gnedenko O., Mukha D., Yantsevich A., Britikov V., Kaluzhskiy L., Yablokov E., Molnar A., Ivanov A., Lisitsa A., Gilep A., Usanov S., Archakov A. pavel79@inbox.ru Accepted 2013-JAN-08 by MGT 04-Feb-2013: Contacted by IntAct-Help. Proteomics (1615-9853) 2012 Only protein-protein interactions imex curation cp3a5_human Cytochrome P450 3A5 CYP3A5 CYPIIIA5 Cytochrome P450-PCN3 protein protein human Homo sapiens Human MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLSGE D5A2302E2633E717 cyb5_human Cytochrome b5 CYB5A CYB5 Microsomal cytochrome b5 type A protein protein human Homo sapiens Human MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED B6AD2AB747555048 cyb5a-cyp3a5 1 3 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A and 3B Sample used in figure 3B was previously submitted to a molecular fishing procedure using cytb5 immobilized in paramagnetic particles (PMPs) and purified cytp3a5 and found to be enriched in comparison to PMPs with immobilized albumin.