MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. FEBS Lett. (0014-5793) 2012 Bányai L., Kerekes K., Patthy L. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bányai L., Kerekes K., Patthy L. FEBS Lett. (0014-5793) 2012 Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. FEBS Lett. (0014-5793) 2012 Bányai L., Kerekes K., Patthy L. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Bányai L., Kerekes K., Patthy L. FEBS Lett. (0014-5793) 2012 wnt5a_mouse Protein Wnt-5a Wnt5a Wnt-5a protein protein mouse Mus musculus Mouse MKKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK DIP protein P22725 original sequence version: 90 64CA36C516D22D8A wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK DIP protein O00755 original sequence version: 133 259EF506CFCD7AB0 wnt11_human Protein Wnt-11 WNT11 protein protein human Homo sapiens Human MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK mint homomint Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters 0E29717C98541DBB wnt4_mouse Protein Wnt-4 Wnt4 Wnt-4 protein protein mouse Mus musculus Mouse MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR 7E1C5C739BE939D9 wif1_human Wnt inhibitory factor 1 WIF1 UNQ191/PRO217 protein protein human Homo sapiens Human MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW DIP protein Q9Y5W5 original sequence version: 99 32ADFA6644833E9D wnt3a_mouse Protein Wnt-3a Wnt3a Wnt-3a protein protein mouse Mus musculus Mouse MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK DIP protein P27467 original sequence version: 126 DIP protein P27467 original sequence version: 101 DIP protein P27467 original sequence version: 121 DIP protein P27467 original sequence version: 140 DIP protein P27467 original sequence version: 109 7ADFC5B38A8EFF63 wnt9b_mouse Protein Wnt-9b Wnt9b Wnt14b Wnt15 Protein Wnt-14b Protein Wnt-15 protein protein mouse Mus musculus Mouse MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR DIP protein O35468 original sequence version: 88 mint C98D7B5F566B70F5 wif1-wnt5a 1 Wnt5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t1 f1 f2 wif1-wnt3a 1 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 wif1-wnt4 1 Wnt4 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t1 wif1-wnt7a 1 Wnt7a 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t1 wif1-wnt9b 1 Wnt9b 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 wif1-wnt11 1 Wnt11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t1 wif1-wnt5a-1 2 WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:06:09 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Tyr13Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association t2 homomint mint In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. wif1-wnt5a-2 2 WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9Y5W5:p.Trp15Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain W R Tue Jul 12 10:06:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:57:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp15arg' Tue Jun 30 19:39:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp15Arg' Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association t2 homomint mint In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. wif1-wnt5a-3 2 WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:02:14 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation increasing Leu32Arg Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association homomint mint t2 f2 In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. wif1-wnt5a-4 2 WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:02:05 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation increasing Phe42Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association homomint mint t2 f2 In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. wif1-wnt5a-5 2 Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:26:34 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Phe27Arg physical association physical association homomint mint In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. t2 wif1-wnt5a-6 2 Wnt-5a 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:26:15 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Ile25Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint In our opinion this interpretation is less likely to hold for mutations of Tyr13, Trp15 and Leu32 that increased affinity for Wnt-binding: since the WIF-domain has an evolutionary established structure therefore changes in structure is more likely to impair function than improve it. Furthermore, since residues Tyr13, Trp15, Ile25, Phe27, Leu32 and Phe42 are all exposed on the surface of the WIF-fold (Figure 3.), we favor the interpretation that they are involved in Wnt-binding. t2 wif1-wnt3a-1 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:26:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Tyr13Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association t2 mint wif1-wnt3a-2 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9Y5W5:p.Trp15Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W R Tue Jul 12 10:22:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:51:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp15arg' Tue Jun 30 20:00:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp15Arg' physical association physical association t2 mint wif1-wnt3a-3 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:24:29 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Ile25Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association t2 mint wif1-wnt3a-4 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:22:58 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Phe27Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association t2 mint wif1-wnt3a-5 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:22:45 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Leu32Arg binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association t2 mint wif1-wnt3a-6 2 Wnt3a 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified WIF 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:19:07 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Phe42Arg physical association physical association t2 mint