IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Cell (0092-8674) 2012 imex curation Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn Accepted 2013-FEB-27 by PPORRAS 27-Mar-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Cell (0092-8674) 2012 imex curation Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn Accepted 2013-FEB-27 by PPORRAS 27-Mar-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Cell (0092-8674) 2012 imex curation Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dong N., Zhu Y., Lu Q., Hu L., Zheng Y., Shao F. Methodology given in PMID: 16855591. Rab GTPases were loaded with GTP. Free nucleotide was removed with a D-Salt column. The single-turnover kinetics of intrinsic and GAP-accelerated GTP hydrolysis were measured by a continuous enzyme-coupled optical assay for the release of inorganic phosphate. Only RABs indicated in the text as significantly stimulated by VirA have been listed. Details of all RAB constructs given in PMID: 16855591, as referenced in the text. Rab37 did not appear in the original construct list so data could not be added. zhuyongqun@zju.edu.cn, shaofeng@nibs.ac.cn Accepted 2013-FEB-27 by PPORRAS 27-Mar-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation rb33b_mouse Ras-related protein Rab-33B Rab33b protein protein mouse Mus musculus Mouse MTSEMESSLEVSFSSSCAVSGASGCLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISLKPETKPAVTCWC DIP protein O35963 original sequence version: 119 EE2B3E482FC4365A aluminium trifluoride aluminium trifluoride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rb39a_human Ras-related protein Rab-39A RAB39A RAB39 protein protein human Homo sapiens Human METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC DIP protein Q14964 original sequence version: 121 ABD121649354D7F5 rab19_mouse Ras-related protein Rab-19 Rab19 protein protein mouse Mus musculus Mouse MQFSSSSRTSDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELIARNSLHLYGESAQQGLSQDSSPVLVAQVPNESTRCTC DIP protein P35294 original sequence version: 111 BAC8008B72A10036 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 vira_shifl Cysteine protease-like VirA virA Effector protein VirA pWR501_0191 CP0181 protein protein shifl Shigella flexneri MQTSNITNHERNDSSWMSTVKSTTEVSWNKLSFCDILLKIITFGIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV DDA0422BF215688F rab38_human Ras-related protein Rab-38 RAB38 Melanoma antigen NY-MEL-1 protein protein human Homo sapiens Human MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS DIP protein P57729 original sequence version: 119 DIP protein P57729 original sequence version: 140 0D16B42A1B237539 rab9a_mouse Ras-related protein Rab-9A Rab9a Rab9 Sid99 Sid 99 protein protein mouse Mus musculus Mouse MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPKPNSSCC DIP protein Q9R0M6 original sequence version: 114 43F490EAA67D2C9A rab6a_mouse Ras-related protein Rab-6A Rab6a Rab6 MNCb-1660 protein protein mouse Mus musculus Mouse MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVNEGGCSC DD08CC2914668FD4 rab35_mouse Ras-related protein Rab-35 Rab35 protein protein mouse Mus musculus Mouse MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC DIP protein Q6PHN9 original sequence version: 90 31EB15D6D42E076E rab18_human Ras-related protein Rab-18 RAB18 protein protein human Homo sapiens Human MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL D1B0F4866547DF77 rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC B2A8F4E3B0FB17D6 rab5c_mouse Ras-related protein Rab-5C Rab5c protein protein mouse Mus musculus Mouse MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN DIP protein P35278 original sequence version: 117 AA5658239D8D77ED q7db50_eco57 espG ECs_4590 E5F08_27545 protein protein eco57 Escherichia coli O157:H7 MINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLFKVLSFGLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSELVEAEIRTANNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLSTTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDIPANAQKLLRDALGLKDTHSSPTRNVIDHGISRHDAEQIARESSGSDKQKAEVVEFLCHPEAATAICSAFYQSFNVPALTLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGMLTNRTSYEVPQGVKCIIDEMVSALQPRYAASETYLQNT 2AF459B8825868D7 rab13_human Ras-related protein Rab-13 RAB13 GIG4 Cell growth-inhibiting gene 4 protein protein protein human Homo sapiens Human MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG DIP protein P51153 original sequence version: 133 141621CB998178DA rab20_human Ras-related protein Rab-20 RAB20 protein protein human Homo sapiens Human MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA A0201E23BBF75DC8 rab24_mouse Ras-related protein Rab-24 Rab24 Rab-16 protein protein mouse Mus musculus Mouse MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMCVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLSQKANPYFYSCCHH 872EA5E2E7B5B0F0 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 rab30_human Ras-related protein Rab-30 RAB30 protein protein human Homo sapiens Human MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN DIP protein Q15771 original sequence version: 126 935E56DBD48DD7C2 rb11a_mouse Ras-related protein Rab-11A Rab11a Rab11 protein protein mouse Mus musculus Mouse MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI 76FC1E113A29B269 gyp1_yeast GTPase-activating protein GYP1 GYP1 YOR070C YOR29-21 GAP for YPT1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGVRSAAKEMHERDHNSDSSSLVTSLMKSWRISSASSSKKPSLYKMNTTESTSLPSGYASSADRDRRTSDGNFEAMAKQQASTRRTSNSYSPLRYVNPTLSTASNESPRPALLLRQHHQRHHHHQQPRHSSSGSVGNNCSNSTEPNKKGDRYFKDLDEDWSAVIDDYNMPIPILTNGGFGTPVAPTRTLSRKSTSSSINSISNMGTSAVRNSSSSFTYPQLPQLQKEKTNDSKKTQLEIENERDVQELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVEIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQEVTSSYSMSSNDIKPPVTPTEPRVASFVTPTKDFQSPTTALSNMTPNNAVEDSGKMRQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDATSHWL 08C1A26B6ED37E13 08C1A26B6ED37E13 rab3a_mouse Ras-related protein Rab-3A Rab3a protein protein mouse Mus musculus Mouse MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC DIP protein P63011 original sequence version: 100 DIP protein P63011 original sequence version: 53 1A3E9F8C9D09EB40 rab15_mouse Ras-related protein Rab-15 Rab15 protein protein mouse Mus musculus Mouse MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIDVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC DIP protein Q8K386 original sequence version: 89 E5C492846DD47F12 rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC DIP protein P20338 original sequence version: 151 983D65E1162741B0 rb22a_mouse Ras-related protein Rab-22A Rab22a Rab22 Rab-14 protein protein mouse Mus musculus Mouse MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGFKLRRQPSEPKRSCC DIP protein P35285 original sequence version: 122 1799B676CA9091F7 gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp-rab1a 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 15 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D, Supp. fig. 5C gtp-rab1a-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 15 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q7BU69:p.Arg188Lys mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Wed May 02 17:43:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg188lys' Tue Jun 30 16:49:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg188Lys' Q7BU69:p.Gln280Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 17:16:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln280ala' Tue Jun 30 17:33:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln280Ala' ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Figs. 1D, 2A, 2B Catalytic efficiency of VirA on Rab1A =kcat/Km, 3.18E5 M−1S−1) gtp-rab6a 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 12 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab6a-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 12 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab33b 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 4 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab33b-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 4 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab35 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 13 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D, Supp. Fig. 5C gtp-rab35-1 1 13 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-gyp1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 15 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 stimulator stimulator unspecified role unspecified role region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Figs. 2A rab1a-vira 3 9 biological role biological role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 biological role biological role bait bait P62820:p.Ser25Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:52:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser25asn' Tue Jun 30 19:01:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser25Asn' P62820:p.Gln70Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:51:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 19:18:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2D gtp-q7db50 1 15 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 17 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q7DB50:p.Arg191Lys mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Wed May 02 16:13:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg208lys' Tue Oct 30 11:55:45 GMT 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg208Lys' Tue Jun 30 18:09:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg191Lys' Q7DB50:p.Gln276Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 17:22:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln293ala' Tue Oct 30 14:07:20 GMT 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln293Ala' Tue Jun 30 17:02:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln276Ala' ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 5A, Supp. Fig. 5C Catalytic efficiency of EspG on Rab1A =kcat/Km, 2.35E5 M−1S−1) aluminium_triflu-gdp 2 5 unspecified role unspecified role neutral component neutral component 9 biological role biological role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 biological role biological role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 29 unspecified role unspecified role neutral component neutral component 111 108 direct interaction direct interaction Supp. Table 1 3.2A Rworking = 0.23 Rfree = 0.25 q7db50-rab1a 2 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2.8A Rworking = 0.23 Rfree = 0.28 Supp. Table 1 aluminium_trif-gdp-1 2 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component 126 124 direct interaction direct interaction 3.1A Rworking = 0.21 Rfree = 0.27 Supp. Table 1 arf6-q7db50 2 15 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 4.1A Rworking = 0.21 Rfree = 0.25 Supp. Table 1 gtp-rab3a 1 25 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab3a-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 25 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab4a 1 27 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab4a-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 27 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab5c 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 16 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab5c-1 1 16 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab9a 1 11 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab9a-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 11 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab35-2 1 13 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab11a 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 23 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab11a-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 23 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab13 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 18 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D, Supp. Fig. 5C gtp-rab13-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 18 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab15 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 26 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range gtpase reaction gtpase reaction Fig. 1D gtp-rab15-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 26 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab18 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 14 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range reegion his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab18-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 14 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab19 1 7 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab19-1 1 7 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab20 1 19 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab20-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 19 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab22a 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 28 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab22a-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 28 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab24 1 20 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab24-1 1 20 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab30 1 22 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-rab30-2 1 9 stimulator stimulator unspecified role unspecified role ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 22 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab38 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 10 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab38-1 1 10 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D, Supp. Fig. 5C gtp-rab38-2 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab39a 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 1D gtp-rab39a-1 1 9 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Fig. 1D gtp-q7db50-1 1 15 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 17 stimulator stimulator unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Supp. Fig. 7C Catalytic efficiency of VirA on Rab1A =kcat/Km, 3.18E5 M−1S−1) gtp-q7db50-2 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 18 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 17 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Supp. Fig. 5C gtp-q7db50-3 1 26 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Supp. Fig.5C gtp-q7db50-4 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 22 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 17 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Supp fig. 5C gtp-q7db50-5 1 17 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction Supp. Fig. 5C gtp-q7db50-6 1 17 stimulator stimulator unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 10 enzyme enzyme unspecified role unspecified role n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Supp. Fig. 5C