MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator. Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator. FEBS Lett. (0014-5793) 2012 Kim JY., So KJ., Lee S., Park JH. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kim JY., So KJ., Lee S., Park JH. FEBS Lett. (0014-5793) 2012 Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator. Bcl-rambo induces apoptosis via interaction with the adenine nucleotide translocator. FEBS Lett. (0014-5793) 2012 Kim JY., So KJ., Lee S., Park JH. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim JY., So KJ., Lee S., Park JH. FEBS Lett. (0014-5793) 2012 b2l13_human Bcl-2-like protein 13 Protein Mil1 Bcl-rambo BCL2L13 MIL1 CD003 protein protein human Homo sapiens Human MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLHKALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSENNSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREPDTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREESLVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVALALRKK DIP protein Q9BXK5 original sequence version: 128 D9404665111B6CE0 ch60_human 60 kDa heat shock protein, mitochondrial HSPD1 HSP60 Heat shock protein 60 60 kDa chaperonin Chaperonin 60 Mitochondrial matrix protein P1 P60 lymphocyte protein HuCHA60 protein protein human Homo sapiens Human MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF DIP protein P10809 original sequence version: 142 E51E1BAD9615899C adt1_human ADP/ATP translocase 1 SLC25A4 ANT1 Adenine nucleotide translocator 1 ADP,ATP carrier protein 1 Solute carrier family 25 member 4 ADP,ATP carrier protein, heart/skeletal muscle isoform T1 AAC1 protein protein human Homo sapiens Human MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV DIP protein P12235 original sequence version: 169 59F0DFAEC4E7CFBB bcl2l13-slc25a4 2 ANT1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Bcl-rambo 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f5c homomint mint bcl2l13-hspd1 1 Bcl-rambo 3 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HSP60 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f2a homomint mint We transiently transfected PC-3 cells with wild-type Bcl-rambo or chimeric mutant plasmids. The staining patterns obtained for Bclrambo, Rambo-Bcl2-TM, and Rambo-BNip3-TM resembled the punctuate mitochondrial distribution of heat shock protein 60 (HSP60) (Fig. 2A) [17]. Rambo-Cyb5-TM and Bcl-ramboΔTM showed a globular or diffuse staining pattern (Fig. 2A).