mpidb The Microbial Protein Interaction Database Interaction of CarD with RNA polymerase mediates Mycobacterium tuberculosis viability, rifampin resistance, and pathogenesis. Interaction of CarD with RNA polymerase mediates Mycobacterium tuberculosis viability, rifampin resistance, and pathogenesis. J. Bacteriol. (0021-9193) 2012 imex curation Weiss L.A., Harrison P.G., Nickels B.E., Glickman M.S., Campbell E.A., Darst S.A., Stallings C.L. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions myctx Mycobacterium tuberculosis beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Weiss L.A., Harrison P.G., Nickels B.E., Glickman M.S., Campbell E.A., Darst S.A., Stallings C.L. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Interaction of CarD with RNA polymerase mediates Mycobacterium tuberculosis viability, rifampin resistance, and pathogenesis. Interaction of CarD with RNA polymerase mediates Mycobacterium tuberculosis viability, rifampin resistance, and pathogenesis. J. Bacteriol. (0021-9193) 2012 imex curation Weiss L.A., Harrison P.G., Nickels B.E., Glickman M.S., Campbell E.A., Darst S.A., Stallings C.L. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions myctx Mycobacterium tuberculosis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Weiss L.A., Harrison P.G., Nickels B.E., Glickman M.S., Campbell E.A., Darst S.A., Stallings C.L. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation rpob_myctu DNA-directed RNA polymerase subunit beta rpoB RNA polymerase subunit beta Transcriptase subunit beta MTCI376.08c Rv0667 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLPDELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA This sequence has been withdrawn from Uniprot. 3DA88DEC6A7DF661 3DA88DEC6A7DF661 mfd_myctu Transcription-repair-coupling factor mfd MTCY10G2.29c Rv1020 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTAPGPACSDTPIAGLVELALSAPTFQQLMQRAGGRPDELTLIAPASARLLVASALARQGPLLVVTATGREADDLAAELRGVFGDAVALLPSWETLPHERLSPGVDTVGTRLMALRRLAHPDDAQLGPPLGVVVTSVRSLLQPMTPQLGMMEPLTLTVGDESPFDGVVARLVELAYTRVDMVGRRGEFAVRGGILDIFAPTAEHPVRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFACRELLLSEDVRARAAQLAARHPAAESTVTGSASDMLAKLAEGIAVDGMEAVLPVLWSDGHALLTDQLPDGTPVLVCDPEKVRTRAADLIRTGREFLEASWSVAALGTAENQAPVDVEQLGGSGFVELDQVRAAAARTGHPWWTLSQLSDESAIELDVRAAPSARGHQRDIDEIFAMLRAHIATGGYAALVAPGTGTAHRVVERLSESDTPAGMLDPGQAPKPGVVGVLQGPLRDGVIIPGANLVVITETDLTGSRVSAAEGKRLAAKRRNIVDPLALTAGDLVVHDQHGIGRFVEMVERTVGGARREYLVLEYASAKRGGGAKNTDKLYVPMDSLDQLSRYVGGQAPALSRLGGSDWANTKTKARRAVREIAGELVSLYAKRQASPGHAFSPDTPWQAELEDAFGFTETVDQLTAIEEVKADMEKPIPMDRVICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPTTLLADQHLQTFGERMSGFPVTIKGLSRFTDAAESRAVIDGLADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVEHKEHIKSLRTHVDVLTMSATPIPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPHDDKQIAAALRRELLRDGQAFYVHNRVSSIDAAAARVRELVPEARVVVAHGQMPEDLLETTVQRFWNREHDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQLRGRVGRSRERGYAYFLYPPQVPLTETAYDRLATIAQNNELGAGMAVALKDLEIRGAGNVLGIEQSGHVAGVGFDLYVRLVGEALETYRDAYRAAADGQTVRTAEEPKDVRIDLPVDAHLPPDYIASDRLRLEGYRRLAAASSDREVAAVVDELTDRYGALPEPARRLAAVARLRLLCRGSGITDVTAASAATVRLSPLTLPDSAQVRLKRMYPGAHYRATTATVQVPIPRAGGLGAPRIRDVELVQMVADLITALAGKPRQHIGITNPSPPGEDGRGRNTTIKERQP DBE48CE5ACF42B7D card_myctu RNA polymerase-binding transcription factor CarD carD Rv3583c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS 15F27E0732FD6AD7 15F27E0732FD6AD7 mfd-p0a680 1 3 unspecified role unspecified role prey prey P9WGY9:p.Ile147Ala P0A680-147-147 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I A Wed May 02 19:21:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile147ala' Tue Jun 30 17:56:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile147Ala' P9WGY9:p.Ser149Ala P0A680-149-149 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:29:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser149ala' Tue Jun 30 19:05:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser149Ala' p0a680-52-440 P0A680-52-440 fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain P9WGY9:p.Lys148Ala P0A680-148-148 mutation mutation certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:10:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys148ala' Tue Jun 30 18:33:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' P9WGY9:p.Glu138Arg P0A680-138-138 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E R Wed May 02 15:27:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu138arg' Tue Jun 30 15:48:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu138Arg' 4 unspecified role unspecified role bait bait physical association physical association figure 1 card-p0a680-2 1 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey P9WGY9:p.Glu138Arg P0A680-138-138 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:54:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu138arg' Tue Jun 30 18:33:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu138Arg' region P0A680-52-440 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P9WGY9:p.Ser149Ala P0A680-149-149 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:11:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser149ala' Tue Jun 30 16:28:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser149Ala' P9WGY9:p.Ile147Ala P0A680-147-147 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I A Wed May 02 20:09:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile147ala' Tue Jun 30 16:14:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile147Ala' P9WGY9:p.Lys148Ala P0A680-148-148 mutation mutation certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:12:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys148ala' Tue Jun 30 17:19:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys148Ala' 19 16 physical association physical association figure 1 card-p0a680-3 2 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P9WJG3:p.Arg47Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:41:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg47glu' Tue Jun 30 18:28:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg47Glu' P9WJG3:p.Arg25Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:00:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg25glu' Tue Jun 30 16:24:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg25Glu' 3 unspecified role unspecified role prey prey physical association physical association figure 2D