mpidb The Microbial Protein Interaction Database The β-lactam resistance protein Blr, a small membrane polypeptide, is a component of the Escherichia coli cell division machinery. The β-lactam resistance protein Blr, a small membrane polypeptide, is a component of the Escherichia coli cell division machinery. J. Bacteriol. (0021-9193) 2012 imex curation Karimova G., Davi M., Ladant D. 18-Dec-2012: Contacted by IntAct-Help. Genomic E. coli chromosomal DNA Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Karimova G., Davi M., Ladant D. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Genomic E. coli chromosomal DNA J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation The β-lactam resistance protein Blr, a small membrane polypeptide, is a component of the Escherichia coli cell division machinery. The β-lactam resistance protein Blr, a small membrane polypeptide, is a component of the Escherichia coli cell division machinery. J. Bacteriol. (0021-9193) 2012 imex curation Karimova G., Davi M., Ladant D. 18-Dec-2012: Contacted by IntAct-Help. Genomic E. coli chromosomal DNA Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Karimova G., Davi M., Ladant D. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Genomic E. coli chromosomal DNA J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation ftsw_ecoli Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Lipid II flippase FtsW Peptidoglycan polymerase JW0087 b0089 protein protein ecoli Escherichia coli (strain K12) MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPMEFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDYETRLEKAQAFVRGSR DIP protein P0ABG4 original sequence version: 39 7935EC952AD9A1F3 flk_ecoli Flagellar regulator flk flk b2321 JW2318 div Fluke protein protein ecoli Escherichia coli (strain K12) MIQPISGPPPGQPPGQGDNLPSGTGNQPLSSQQRTSLESLMTKVTSLTQQQRAELWAGIRHDIGLSGDSPLLSRHFPAAEHNLAQRLLAAQKSHSARQLLAQLGEYLRLGNNRQAVTDYIRHNFGQTPLNQLSPEQLKTILTLLQEGKMVIPQPQQREATDRPLLPAEHNALKQLVTKLAAATGEPSKQIWQSMLELSGVKDGELIPAKLFNHLVTWLQARQTLSQQNTPTLESLQMTLKQPLDASELAALSAYIQQKYGLSAQSSLSSAQAEDILNQLYQRRVKGIDPRVMQPLLNPFPPMMDTLQNMATRPALWILLVAIILMLVWLVR 9201E5BF4B9D27FB yfgm_ecoli Ancillary SecYEG translocon subunit yfgM Periplasmic chaperone YfgM JW2497 b2513 protein protein ecoli Escherichia coli (strain K12) MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSDENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDVTPALSEMMQMKINNLSI 2DAFC595EBDC5EEB blr_ecoli Divisome-associated membrane protein Blr blr Beta-lactam resistance protein JW5963 b4409 protein protein ecoli Escherichia coli (strain K12) MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSASVQHK D384EBB01276D46B ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 rsea_ecoli Anti-sigma-E factor RseA yfiJ rseA mclA b2572 JW2556 Regulator of SigE Sigma-E anti-sigma factor RseA Sigma-E factor negative regulatory protein protein protein ecoli Escherichia coli (strain K12) MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ DIP protein P0AFX7 original sequence version: 71 DIP protein P0AFX7 original sequence version: 40 DIP protein P0AFX7 original sequence version: 39 DIP protein P0AFX7 original sequence version: 76 63BD12131C611C32 ftsl_ecoli Cell division protein FtsL ftsL mraR b0083 JW0081 yabD protein protein ecoli Escherichia coli (strain K12) MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQK 6DD5DF7B2ECB7090 ftsk_ecoli DNA translocase FtsK ftsK b0890 JW0873 protein protein ecoli Escherichia coli (strain K12) MSQEYIEDKEVTLTKLSSGRRLLEALLILIVLFAVWLMAALLSFNPSDPSWSQTAWHEPIHNLGGMPGAWLADTLFFIFGVMAYTIPVIIVGGCWFAWRHQSSDEYIDYFAVSLRIIGVLALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHSSGGTIALLCVWAAGLTLFTGWSWVTIAEKLGGWILNILTFASNRTRRDDTWVDEDEYEDDEEYEDENHGKQHESRRARILRGALARRKRLAEKFINPMGRQTDAALFSGKRMDDDEEITYTARGVAADPDDVLFSGNRATQPEYDEYDPLLNGAPITEPVAVAAAATTATQSWAAPVEPVTQTPPVASVDVPPAQPTVAWQPVPGPQTGEPVIAPAPEGYPQQSQYAQPAVQYNEPLQQPVQPQQPYYAPAAEQPAQQPYYAPAPEQPVAGNAWQAEEQQSTFAPQSTYQTEQTYQQPAAQEPLYQQPQPVEQQPVVEPEPVVEETKPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKEPEPIKSSLKAPSVAAVPPVEAAAAVSPLASGVKKATLATGAAATVAAPVFSLANSGGPRPQVKEGIGPQLPRPKRIRVPTRRELASYGIKLPSQRAAEEKAREAQRNQYDSGDQYNDDEIDAMQQDELARQFAQTQQQRYGEQYQHDVPVNAEDADAAAEAELARQFAQTQQQRYSGEQPAGANPFSLDDFEFSPMKALLDDGPHEPLFTPIVEPVQQPQQPVAPQQQYQQPQQPVPPQPQYQQPQQPVAPQPQYQQPQQPVAPQQQYQQPQQPVAPQQQYQQPQQPVAPQPQDTLLHPLLMRNGDSRPLHKPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWKPGDSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLGMGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGAGGFDGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD DIP protein P46889 original sequence version: null ED24BFB464481CFC ftsi_ecoli Peptidoglycan D,D-transpeptidase FtsI ftsI pbpB b0084 Penicillin-binding protein 3 JW0082 Essential cell division protein FtsI Murein transpeptidase Peptidoglycan synthase FtsI protein protein ecoli Escherichia coli (strain K12) MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS DIP protein P0AD68 original sequence version: 84 This sequence has been withdrawn from Uniprot. C89A403D5980B2CD ftsq_ecoli Cell division protein FtsQ ftsQ b0093 JW0091 protein protein ecoli Escherichia coli (strain K12) MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ 839A3D34B948CEAB ftsl-flk 2 4 unspecified role unspecified role prey prey region P15286-114-331 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Table 4 ftsl-rsea 2 8 unspecified role unspecified role prey prey region P0AFX7-68-216 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Table 4 ftsl-yfgm 2 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region P76576-17-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 4 ftsl-blr 2 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region P56976-3-41 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 4 ftsl-ftsi 2 11 unspecified role unspecified role prey prey region P0AD68-9-193 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Table 4 ftsl-ftsw-1 2 3 unspecified role unspecified role prey prey region P0ABG4-23-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Table 4 blr-ftsn-1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P56976:p.Val12[2] P56976-12-13 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed May 02 15:13:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val12val_val' Tue Jun 30 18:37:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val12[2]' physical association physical association Figure 1, 6 blr-ftsk-1 1 10 unspecified role unspecified role prey prey p46889-1-271 P46889-1-271 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait val12val_val P56976-12-13 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed Jul 06 16:34:28 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'p56976-12-13' physical association physical association Figure 1, 6 blr-ftsi-1 1 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait val12val_val P56976-12-13 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed Jul 06 16:34:29 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'p56976-12-13' physical association physical association Figure 1 blr-yfgm-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P56976:p.Val12[2] P56976-12-13 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed May 02 15:03:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val12val_val' Tue Jun 30 18:23:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val12[2]' physical association physical association Figure 1, 6 blr-ftsq-1 1 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait val12val_val P56976-12-13 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:34 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'p56976-12-13' physical association physical association Figure 1 blr-ftsl-1 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P56976:p.Val12[2] P56976-12-13 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed May 02 18:12:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val12val_val' Tue Jun 30 20:04:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val12[2]' physical association physical association Figure 1 blr-ftsw-1 1 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P56976:p.Val12[2] P56976-12-13 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain V VV Wed May 02 15:14:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val12val_val' Tue Jun 30 19:49:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val12[2]' physical association physical association Figure 1, 6 yfgm-blr 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1 ftsn-blr 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1 ftsk-blr 1 10 unspecified role unspecified role bait bait p46889-1-271 P46889-1-271 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Figure 1 ftsi-blr 1 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1 ftsl-blr-1 1 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 1 blr-ftsn-2 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P56976:p.Val12[2] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V VV Wed May 02 15:25:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val12val_val' Tue Jun 30 17:32:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val12[2]' physical association physical association Figure 1