IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Cell (0092-8674) 2012 imex curation Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. kuguan@ucsd.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. kuguan@ucsd.edu Accepted 2012-NOV-05 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Cell (0092-8674) 2012 imex curation Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. kuguan@ucsd.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. Following immunoprecipitation, protein beads were washed with wash buffer and then kinase assay buffer. Additional detail on constructs obtained from the author. kuguan@ucsd.edu Accepted 2012-NOV-05 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Regulation of the Hippo-YAP Pathway by G-Protein-Coupled Receptor Signaling. Cell (0092-8674) 2012 imex curation Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. kuguan@ucsd.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yu F.X., Zhao B., Panupinthu N., Jewell J.L., Lian I., Wang L.H., Zhao J., Yuan H., Tumaneng K., Li H., Fu X.D., Mills G.B., Guan K.L. They are a bit vague about cell lines throughout - I have assumed HEK293 cells unless they specifically state otherwise as this appears to be the default used throughout. Following immunoprecipitation, protein beads were washed with wash buffer and then kinase assay buffer. Additional detail on constructs obtained from the author. kuguan@ucsd.edu Accepted 2012-NOV-05 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE mob1b_human MOB kinase activator 1B MOB1B MOB4A MOBKL1A Mob1 homolog 1A Mob1B Mps one binder kinase activator-like 1A protein protein human Homo sapiens Human MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR 29EBA287B0CDAF90 lats1_human Serine/threonine-protein kinase LATS1 Large tumor suppressor homolog 1 WARTS protein kinase LATS1 WARTS protein protein human Homo sapiens Human MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV DIP protein O95835 original sequence version: 133 DIP protein O95835 original sequence version: 147 DIP protein O95835 original sequence version: 144 DIP protein O95835 original sequence version: 142 DIP protein O95835-1 original sequence version: 142 11CFBCD8FD87DCD8 stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF 150758EBC5F77D5C lats2_mouse Serine/threonine-protein kinase LATS2 Lats2 Kinase phosphorylated during mitosis protein Large tumor suppressor homolog 2 Serine/threonine-protein kinase kpm protein protein mouse Mus musculus Mouse MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDTSLDAKVLGSKDASRQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAPTPVTRRPSFEGTGEALPSYHQLGGANYEGPAALEEMPRQYLDFLFPGAGAGTHGAQAHQHPPKGYSTAVEPSAHFPGTHYGRGHLLSEQPGYGVQRSSSFQNKTPPDAYSSMAKAQGGPPASLTFPAHAGLYTASHHKPAATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLNADLYELGSTVPWSAAPLARRDSLQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVAAPTAPATESLETKEGSAGPHPLDVDYGGSERRCPPPPYPKHLLLPSKSEQYSVDLDSLCTSVQQSLRGGTEQDRSDKSHKGAKGDKAGRDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVSRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKLDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHMRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWESTLHIPTQVRLSAEARDLITKLCCAADCRLGRDGADDLKAHPFFNTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDEESPWHEASGESAKAWDTLASPSSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPGDADLEGAAEGCQPVYV 7E0E73A73DB954C0 tead1_human Transcriptional enhancer factor TEF-1 TEA domain family member 1 Protein GT-IIC Transcription factor 13 NTEF-1 TEAD1 TCF13 TEF1 protein protein human Homo sapiens Human MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVKD DIP protein P28347 original sequence version: 152 DIP protein P28347 original sequence version: 155 EFD8067F2770B3C7 yap1-tead1-1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association Fig. 3B Treatment with serum or lysophosphatidic acid increased binding of YAP1 to TEAD1 but inhibited binding of YAP1 to YWHAQ yap1-tead1-2 1 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 3B Treatment with serum or lysophosphatidic acid increased binding of YAP1 to TEAD1 but inhibited binding of YAP1 to YWHAQ mob1b-stk4-1 3 8 enzyme enzyme neutral component neutral component human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supp. Fig. 5A lats1-yap1-2 2 5 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation Fig. 5B, Supp. Fig. 5C, 6F, 6G Lysophosphatidic acid (LPA) Sphingosine 1-phosphophate (S1P) Serum Inactivation of Rho GTPases by C3 treatment effectively blocked Lats1 inhibition by LPA, S1P, and serum. LPA receptor antagonist Ki16425 blocks the effect of LPA on Lats kinase inhibition. stk4-1 3 8 putative self putative self putative self putative self human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true Supp. Fig. 5A lats2-yap1-1 2 9 enzyme enzyme neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 5 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supp. Fig. 6E Cotransfection of active Vomeronasal 1 receptors G12, G13, and RhoA repressed Lats2 kinase activity lats1-yap1-3 2 5 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma phosphorylation phosphorylation reaction phosphorylation Supp. Fig. 7F Epinephrine