IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-white_adipose Mus musculus white_adipose white adipose tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Epididymal and inguinal White Adipose Tissue was used. Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-hib1b mouse brown fat tumour cell line HIB-1B hib1b Brown fat tumour cell line HIB-1B ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes The experiment appears to be a re-chip, with two rounds of immunoprecipitation but the order of immunoprecipitations is not given. Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Brown Remodeling of White Adipose Tissue by SirT1-Dependent Deacetylation of Pparγ. Cell (0092-8674) 2012 imex curation Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-white_adipose Mus musculus white_adipose white adipose tissue anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Qiang L., Wang L., Kon N., Zhao W., Lee S., Zhang Y., Rosenbaum M., Zhao Y., Gu W., Farmer S.R., Accili D. Diabetes - Interactions investigated in the context of Diabetes Additional details of constructs obtained from the author. da230@columbia.edu Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation pparg_mouse Peroxisome proliferator-activated receptor gamma Pparg Nr1c3 Nuclear receptor subfamily 1 group C member 3 protein protein mouse Mus musculus Mouse MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY AB8F3F6086E2A10A prd16_mouse Histone-lysine N-methyltransferase PRDM16 PR domain zinc finger protein 16 Prdm16 Kiaa1675 Mel1 PR domain-containing protein 16 Transcription factor MEL1 protein protein mouse Mus musculus Mouse MRSKARARKLAKSDGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSEDFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTPRAALKEADFGWEMLTDTEVSSQESCIKKQISEDLGSEKFCVDANQAGSGSWLKYIRVACSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDECDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPNKYSLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDKTKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLPPTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGPGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVEEEEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRCVEERGGGLLALEPTPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTLYRQAKNQAYAMMLSLSEDTPLHAPSQSSLDAWLNITGPSSESGAFNPINHL DIP protein A2A935 original sequence version: 55 2F1F6B6C3EBFEC10 p37238-1 Peroxisome proliferator-activated receptor gamma Pparg Nr1c3 Nuclear receptor subfamily 1 group C member 3 protein protein mouse Mus musculus Mouse MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY DIP protein P37238-1 original sequence version: 127 DIP protein P37238-1 original sequence version: 134 AB8F3F6086E2A10A ucp1_mouse_gene Mitochondrial brown fat uncoupling protein 1 gene gene mouse Mus musculus Mouse sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS DIP protein Q923E4 original sequence version: 83 DIP protein Q923E4 original sequence version: 135 7F15625E29433119 sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F pparg-sirt1-7 4 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A Rosiglitazone (PPAR-gamma agonist) pparg-sirt1-8 1 9 unspecified role unspecified role bait bait P37238-1:p.Pro495Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P L Wed May 02 18:55:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro495leu' Tue Jun 30 18:20:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro495Leu' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P37238-1:p.Leu496_Leu497delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Wed May 02 14:53:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu496-497ala_ala' Tue Jun 30 20:17:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu496_Leu497delinsAlaAla' 12 unspecified role unspecified role prey prey physical association physical association Fig. 1B, 5D, 5E GW9662 (PPAR-gamma antagonist) P495L Pparγ was hyperacetylated, and showed reduced binding to SirT1. (Numbering is given for the Human protein -P467L, P37231-1). Troglitazone -a thiazolidinedione - anti-diabetic drug. pparg-sirt1-4 3 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 1F sirt1-sirt1 6 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1G, 5H Pparg acetylation decreased in inguinal white adipose tissue when brown tissue genes were activated by cold exposure , while it increased with insulin resistance brought about by a high-fat diet. The increase of Pparg acetylation following high-fat diet was associated with reduced interaction with SirT1. pparg-sirt1-9 2 12 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96EB6:p.His363Tyr mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 16:57:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his363tyr' Tue Jun 30 19:07:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His363Tyr' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. deacetylation deacetylation reaction deacetylation Fig. 1E Nicotinamide (SirT1 inhibitor) pparg-prdm16 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P37238-1:p.Lys268Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:16:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys268arg' Tue Jun 30 18:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys268Arg' P37238-1:p.Lys293Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:03:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys293arg' Tue Jun 30 16:07:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys293Arg' physical association physical association Fig. 7A-D, 7F Rosiglitazone (PPAR-gamma agonist) Pparg acetylation by Cbp prevented Prdm16 binding. Expression of SirT1 promotes Pparγ interaction with Prdm16. SirT1 gain-of-function mimicked the effect of Pparγ ligand to promote Prdm16 binding while the Pparγ antagonist GW9662 blocked the effect of SirT1 ucp1-pparg 5 10 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role unspecified role unspecified role 7 unspecified role unspecified role unspecified role unspecified role association association Fig. 7E Interaction observed only when catalytically active Sirtt1 is expressed in the cells. sirt1-pparg-2 4 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A Rosiglitazone (PPAR-gamma agonist)