MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. FEBS Lett. (0014-5793) 2012 Park OK., Park HH. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Park OK., Park HH. FEBS Lett. (0014-5793) 2012 Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. FEBS Lett. (0014-5793) 2012 Park OK., Park HH. in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Park OK., Park HH. FEBS Lett. (0014-5793) 2012 q0e9b7_drome Drep3 Drep-3 Rep3 BcDNA:AT08574 CG13187 DREP-3 Dmel\CG8364 drep-3 drep3 CG8364 Dmel_CG8364 DREP3 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIVAPPPRQRTLTRTAELDADCEDIELDADDGLDDAADSITLELALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANLRRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKDNEYSARSDAARLSTELSC 7CA5185EB8ABB04B q9u787_drome Drep2 Drep-2 Rep2 drep2 CG1975 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAREESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWYPTGVDVIKAAISAIPKIVCETIHALELHDETPSWKIMDNKGRVTVVLHWDQRQGGGSGGGESGGAGGGVGSMCSRLGSSNGLLSSDKYSPSKKGLSAQSSLDNKSVSSQSSQPRYASPQITVISDDGPASIYHPGGVVLPPGVVIPGGSRRLSKQGSSFDSTVGVGVGAVHVHTPECAHHAHTPSRAGSPSTTECDFHCCALHEEGRKIAVHKSVATSPIQDGSSSPQPQSAPSVMDPMLGGSGGGGSGSMQRRSSGAKGHVRFLDIAPERDSSESETENTVMEDDKTTTEKFLLLIDQLSVDQKRHLSIKDIGIILERLNSKILDVERLDRESESDDCYNWTIKATIRGDALRELGVIYNANYYAISEHPGYKEELEENGEEVEEEEEEDEEDRI mint 2B5D8B774715898C drep_2-drep_3 1 Drep2 CIDE 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Drep-3 CIDE 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2a mint drep_2-drep_3-1 2 Drep2 CIDE 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Drep-3 CIDE 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2b mint