IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Activity-Dependent Transport of the Transcriptional Coactivator CRTC1 from Synapse to Nucleus. Activity-Dependent Transport of the Transcriptional Coactivator CRTC1 from Synapse to Nucleus. Cell (0092-8674) 2012 imex curation Ch'ng T.H., Uzgil B., Lin P., Avliyakulov N.K., O'Dell T.J., Martin K.C. Ywhae residue numbering is based on the Yaffe paper (PMID:9428519), which actually refers to Ywhaz. The sequences has been aligned and mutant remapped. Not added any colocalization with MAP2, synaptotagmin, or PSD95 as these were used as markers of cell type. Source of Ywhae inferred from previous work of donating scientist (PMID:22827337) kcmartin@mednet.ucla.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ch'ng T.H., Uzgil B., Lin P., Avliyakulov N.K., O'Dell T.J., Martin K.C. Ywhae residue numbering is based on the Yaffe paper (PMID:9428519), which actually refers to Ywhaz. The sequences has been aligned and mutant remapped. Not added any colocalization with MAP2, synaptotagmin, or PSD95 as these were used as markers of cell type. Source of Ywhae inferred from previous work of donating scientist (PMID:22827337) kcmartin@mednet.ucla.edu Accepted 2012-AUG-10 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Activity-Dependent Transport of the Transcriptional Coactivator CRTC1 from Synapse to Nucleus. Activity-Dependent Transport of the Transcriptional Coactivator CRTC1 from Synapse to Nucleus. Cell (0092-8674) 2012 imex curation Ch'ng T.H., Uzgil B., Lin P., Avliyakulov N.K., O'Dell T.J., Martin K.C. Ywhae residue numbering is based on the Yaffe paper (PMID:9428519), which actually refers to Ywhaz. The sequences has been aligned and mutant remapped. Not added any colocalization with MAP2, synaptotagmin, or PSD95 as these were used as markers of cell type. Source of Ywhae inferred from previous work of donating scientist (PMID:22827337) kcmartin@mednet.ucla.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunostaining immunostaining Ch'ng T.H., Uzgil B., Lin P., Avliyakulov N.K., O'Dell T.J., Martin K.C. Ywhae residue numbering is based on the Yaffe paper (PMID:9428519), which actually refers to Ywhaz. The sequences has been aligned and mutant remapped. Not added any colocalization with MAP2, synaptotagmin, or PSD95 as these were used as markers of cell type. Source of Ywhae inferred from previous work of donating scientist (PMID:22827337) kcmartin@mednet.ucla.edu Accepted 2012-AUG-10 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation crtc1_rat CREB-regulated transcription coactivator 1 Crtc1 Mect1 Torc1 Mucoepidermoid carcinoma translocated protein 1 homolog Transducer of regulated cAMP response element-binding protein 1 protein protein rat Rattus norvegicus (Rat) Rat MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSSSMDLSFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTVYLSPPADTSWRRTNSDSALHQSTMTPTQAESFTGGPQDAHQKRVLLLTVPGMEETGSETDKTLSKQSWDSKKAGSRPKSCEVPGINIFPSADQENTAALIPATHNTGGSLPDLSTIHFPSPLPTPLDPEEPPFPALTSSGSTGSLAHLGVGGTGQGMNTPSSSPQRRPAVVSPLSLSTEARRQQAQQVPPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPVSQQQPPPPQVSVGLPQGGPLLPSASLTRGPQLPPLAVTVPSTLPQSPTESPGQPPMGIDVTSAPALQYRTGAGSPATQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMTARQANALSRQLEQFNMMENAISSSSLYNPGSTLNYSQAAMMGLSGSHGGLQDPQQLGYAGHGGIPNIILTVTGESPPSLSKELSSTLAGVSDVSFDSDHQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL 2ABD42BE1F0D1095 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62260 original sequence version: 67 07817CCBD1F75B26 crtc1-ywhae 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1F ywhae-crtc1 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P62260:p.Lys50Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:00:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys50glu' Tue Jun 30 17:52:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys50Glu' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell physical association physical association Fig 1G Bicuculline ( GABAA receptor antagonist)