IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Cell (0092-8674) 2012 imex curation Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. no Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. Other PP2A subunits were identified in the pulldown but could not be ascribed to a single gene product. mattaj@embl.org Accepted 2012-AUG-09 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Cell (0092-8674) 2012 imex curation Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org Accepted 2012-AUG-09 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Cell (0092-8674) 2012 imex curation Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. Untagged proteins visualised by immunostaining. mattaj@embl.org Accepted 2012-AUG-09 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Coordination of Kinase and Phosphatase Activities by Lem4 Enables Nuclear Envelope Reassembly during Mitosis. Cell (0092-8674) 2012 imex curation Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Asencio C., Davidson I.F., Santarella-Mellwig R., Ly-Hartig T.B., Mall M., Wallenfang M.R., Mattaj I.W., Gorjanacz M. Reactions involving Histone H3, CDK1 and phosphatase lambda not captured as source of protein could not be traced. mattaj@embl.org Accepted 2012-AUG-09 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation baf1_caeel Barrier-to-autointegration factor 1 baf-1 B0464.7 protein protein caeel Caenorhabditis elegans MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETAGVTANHAKTAFNCLNEWADQFM 9DE71FABDC53245F lem2_caeel LEM protein 2 lem-2 Ce-MAN1 MAN1 homolog W01G7.5 protein protein caeel Caenorhabditis elegans MVDVEKMSDAELRAELNVRGANVGPVTGTTRSLYEKKLKKLLSGGAKTPARPTVAKPAPKPTPKSAPAPKSPKSPPARRSIPRAAATAANSTINSTFNRSEIEEMSDSDDDMRDDDDDDEEILSPKSKQSSFRSANSTASSVGRGRPVSSTPNKRLSPVYKPSPVPKNTPRTTSSSSKTTINTTTTRIPSTPRRITSVPGLITDFTPSFSTFGSDRPGATPPRKSIYTSKVSKVLHDLGNTTGEEDDDDEFEGQETSRIIYKTEEPSRRGIVKNAWNKVLGYGFDASKNPGDSYDLRAGASRIRVQKNPRTGKVTVKQTNIFNEAIYFALYVILILFVVLGIAYALTTTHRPKTADFSGYWGVLKAAGRDSLNFFYNYAILPVVSLGIFVVLGAGIYFGHRKYKEAKEQEEAKLYELIERITELIRESSIDGDPYVSQPHVRDVLFPPAKRRSAELARWEQAVKFIDTNESRVATDVLVLPSGNECAVWKWIGNQSQKRW E5B25805D4A422BE ankl2_caeel Ankyrin repeat and LEM domain-containing protein 2 homolog lem-4 LEM domain-containing protein 4-like lem-4l Y55F3BR.8 protein protein caeel Caenorhabditis elegans MGRKSAILAVILAIIYFRSNFSKMSNTPVQETEGPVYVAYSMEDMLKSPRDLYKSVKEVAKFVNSAEGKSMSARFKKFGTPREAMDFLAYGDAPTTPKTVPPVAPTEPNSPFSGVNRIQMNEFKKYVEKGDMENFLRLVDSNPRFLVNTGGDVASIVMEGFRYNALHIAAKAGQTEIIAKILELIQNIDFLIRLYGTGADDVTLRKINILDSYLNTPDKGNSDTPLHFASKFGKIGVVRVLTENSATDRTLLNKSGKSALDCAGERYTGEDKDMVQRDIHLAIEGFYVFLHRNPTTGSTQLTVSQKPPATYSTSPTTATVTVSAQAGPFFTEREARDFAKSWQTAGKELKRTDFDKGWERVGRVLAEQSEAMWRETWHFLGSMELLDLGSEQGLGVLEAFLREKRRGNLRNSEISEISTKKSIFRRGIHARKLDFGILDGEKSAEISENLTPDGSDSADDEDDDDIFYDTFSEIPAAAEKSINDPDDTLGSLTDRFAAISIFSPLPPPPPPQWSNSPNFDYSEGEDSFATPPTTPPPTFVADDEPCKIDNDLFEVLAQISSELISKFPLTQDYVQKLGKLTAHDRSTWRPIDSPARCDSRRKI 64AE263FC7673C92 emr1_caeel Emerin homolog 1 emr-1 Ce-emerin M01D7.6 protein protein caeel Caenorhabditis elegans MDVSQLTDAELRDSLKSHGVSVGPIVATTRKLYEKKLIKLSDGSINNQSNLNDSQFNEDSLIISSSPKKSPPQRVFQNVSAATAAATTSPESDSDDCEESMRYLTEEEMAADRASARQAQSNKGGFLGSTITFTILFVFIAVFAYFLIENAEQLKLVAETNPEDTI 9D649883FFDEBE15 2aba_human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform PPP2R2A PP2A subunit B isoform alpha PP2A subunit B isoform B55-alpha PP2A subunit B isoform PR55-alpha PP2A subunit B isoform R2-alpha protein protein human Homo sapiens Human MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN DIP protein P63151 original sequence version: 33 DIP protein P63151 original sequence version: 66 F4D407FF7ADA4ED6 vrk1_caeel Serine/threonine-protein kinase VRK1 vrk-1 F28B12.3 Vaccinia-related kinase 1 protein protein caeel Caenorhabditis elegans MPPKKAPAKKLHELAAEVRVGHKINDISKKTFIVGKQFATGGFGRIHTCTEEGKSQQMVMKIEPSTNGPLLTEVVVFNRILKKELIESYKKKKKISWIGLPYLIANGYFTYESEKMRYMIIPKYATSLEAVRETNGGTLAMKDSLTVASCILDALEYLHESDYAHADVKAANILLEKQGVYSTAVLVDFGLAHRTTNNVDKPDKKRAHNGTCIFTSTDAHRGNNPSFRGDIEILAYNLMMWATGTLPWMALESSPEKVFDAKQKFIAGLPGTLQNVLKNESSAVVGCIASMFDISMKTNYTDKVDMGKLKKLVTDAIQKTSSDGKKTPTRQKKLAEEDKNAVTPKRSTRRLAVKEESDNKDNDEVEVKPEKKATPRKRTTRKAVEVNNDSDDNEEQYENPKSKSSRTQTKSKRAKEEDVDDEEEIIIPKSSRSRSKVQLSGEGSDVTTPSSAASTSRSRSIRLGLTSSTASSNKVAKKIEQKYKRLSMNKSSLVPVTISVASDKSPTTSTPSSSSGLRSKRKSSEDVGEGITLKTQVLITPAIKKAKTKSGISSATKASPTELRRVPGVRNFPKGRRSMIIKETSAKYKERLASRQTKPTFDDSSCSSEV 9C23F0BCBA948FB6 ankl2_human Ankyrin repeat and LEM domain-containing protein 2 ANKLE2 KIAA0692 LEM domain-containing protein 4 LEM4 protein protein human Homo sapiens Human MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPSAAAAPASGEMTMDALLARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSFYHHEAGVTALSQDPQRILKPAEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPPSDTDTYRAGATASKEPPLYYGVCPVYEDVPARNERIYVYENKKEALQAVKMIKGSRFKAFSTREDAEKFARGICDYFPSPSKTSLPLSPVKTAPLFSNDRLKDGLCLSESETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPLLRAEETSSPVIGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPERGFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEIGKKAQQETGEREASCRDKATTSGSNSISVRAFLDEDDMSLEEIKNRQNAARNNSPPTVGAFGHTRCSAFPLEQEADLIEAAEPGGPHSSRNGLCHPLNHSRTLAGKRPKAPRGEEAHLPPVSDLTVEFDKLNLQNIGRSVSKTPDESTKTKDQILTSRINAVERDLLEPSPADQLGNGHRRTESEMSARIAKMSLSPSSPRHEDQLEVTREPARRLFLFGEEPSKLDQDVLAALECADVDPHQFPAVHRWKSAVLCYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLGSPGRYSPVHGSQLRRMARLAELAAL ED2F25F05E8106F2 vrk_1-h2kzb2 4 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A vrk_1-ankle2 4 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5A baf_1-vrk_1-1 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region zz tag zz tag ZZ tag ZZ tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 5B, 5D, 5E, Supp. Fig. 4A Addition of either human ANKLE2 aa 59–938 or C. elegans LEM-4L aa 257–600 strongly inhibited BAF-1 phosphorylation by VRK-1 vrk-2 2 10 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Fig. 5B, 5D, 5E baf_1-h2kzb2 2 7 inhibitor inhibitor unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region zz tag zz tag ZZ tag ZZ tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 5B, 5D, Supp. Fig. 4A, 4B Addition of either human ANKLE2 aa 59–938 or C. elegans LEM-4L aa 257–600 strongly inhibited BAF-1 phosphorylation by VRK-1 ankle2-baf_1 2 11 inhibitor inhibitor unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region zz tag zz tag ZZ tag ZZ tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 5B, 5D, Supp. Fig. 4A Addition of either human ANKLE2 aa 59–938 or C. elegans LEM-4L aa 257–600 strongly inhibited BAF-1 phosphorylation by VRK-1 ankle2-ppp2r2a 1 9 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 6B, Supp. Fig. 5 emr_1-lem_2 3 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp. figs. 1G, 7A