MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. FEBS Lett. (0014-5793) 2012 Chen CC., Lee JC., Chang MC. suggested by lperfetto in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chen CC., Lee JC., Chang MC. suggested by lperfetto FEBS Lett. (0014-5793) 2012 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. FEBS Lett. (0014-5793) 2012 Chen CC., Lee JC., Chang MC. suggested by lperfetto human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen CC., Lee JC., Chang MC. suggested by lperfetto FEBS Lett. (0014-5793) 2012 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2. FEBS Lett. (0014-5793) 2012 Chen CC., Lee JC., Chang MC. suggested by lperfetto human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen CC., Lee JC., Chang MC. suggested by lperfetto FEBS Lett. (0014-5793) 2012 rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 4ebp3_human Eukaryotic translation initiation factor 4E-binding protein 3 EIF4EBP3 protein protein human Homo sapiens Human MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI FD29A7F3829E546E eif4ebp3-rpa2 3 RPA2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4EBP3 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf2 mint eif4ebp3-rpa2-1 2 RPA2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4EBP3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3a f3c mint The same interaction has been detected in MCF7 cells. we examined whether the RPA2/4E-BP3 complex could be detected after treating these cells with UV light (50 J/m2 4 after1 h). The results showed 5 that the RPA2/4E-BP3 interaction disappeared after the cells were exposed to UV 6 light, suggesting that phosphorylated RPA2 could not interact with 4E-BP3 (Fig. 3C). eif4ebp3-rpa2-2 1 RPA2 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4EBP3 5 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f3b mint