MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10. Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10. FEBS Lett. (0014-5793) 2012 Gu J., Shi J., Wu S., Jin N., Qian W., Zhou J., Iqbal IG., Iqbal K., Gong CX., Liu F. suggested by lperfetto human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gu J., Shi J., Wu S., Jin N., Qian W., Zhou J., Iqbal IG., Iqbal K., Gong CX., Liu F. suggested by lperfetto FEBS Lett. (0014-5793) 2012 kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB srsf7_human Serine/arginine-rich splicing factor 7 SRSF7 Splicing factor 9G8 SFRS7 Splicing factor, arginine/serine-rich 7 protein protein human Homo sapiens Human MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD DIP protein Q16629 original sequence version: 145 49136754D9630853 srsf7-prkaca 1 PKACalpha 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9G8 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c homomint mint