MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Significant stabilization of ribonuclease A by additive effects. Significant stabilization of ribonuclease A by additive effects. FEBS J. (1742-464X) 2012 Arnold U., Schöpfel M. ulrich.arnold@biochemtech.uni-halle.de in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Arnold U., Schöpfel M. ulrich.arnold@biochemtech.uni-halle.de FEBS J. (1742-464X) 2012 rnas1_bovin Ribonuclease pancreatic RNASE1 RNS1 RNase 1 RNase A protein protein bovin Bos taurus (Bovine) Bovine MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV DIP protein P61823 original sequence version: 104 74E5DC61E679187D rnase1-3 1 RNase A 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 2.0 direct interaction direct interaction mint PDB accession codes 3QL2 The variant A4C/D83E/V118C-RNase A crystallized in two crystal forms (I and II), both in the space group C2. Crystal form I, grown in the presence of 0.1 M sodium acetate (pH 4.6), 0.2 M ammonium sulfate, 25% (w/v) polyethylene glycol 4000, and 10 mM CuCl2 , diffracted to 1.29 Å and contains one molecule in the asymmetric unit; crystallization conditions for crystal form II, which diffracted to 1.49 Å and contains two molecules in the asymmetric unit, were 0.1 M sodium acetate (pH 4.6), 0.2 M ammonium sulfate, 25% (w/v) polyethylene glycol 4000, and 10 mM CaCl2 . f2 st3 sf2 sf3 sf4