MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Drosophila Bicoid is a substrate of sumoylation and its activator function is subject to inhibition by this post-translational modification. Drosophila Bicoid is a substrate of sumoylation and its activator function is subject to inhibition by this post-translational modification. FEBS Lett. (0014-5793) 2012 Liu J., Ma J. suggested by lperfetto drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu J., Ma J. suggested by lperfetto FEBS Lett. (0014-5793) 2012 o97102_drome Small ubiquitin-related modifier smt3 Smt3 DmSUMO-1 Dm0342 DmSmt3 Dmel\CG4494 Dmsmt3 SMT3 SUMO Sumo anon-EST:Posey240 dSmt3 dsmt3 l(2)04493 l(2)SH0182 l(2)SH2 0182 CG4494 sumo Dmel_CG4494 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP E49DA04C24A13CA5 bcd_drome Homeotic protein bicoid bcd CG1034 PRD-4 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN 561D8509D5C11FD3 bcd-smt3 1 Bicoid 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SUMO 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1f mint smt3-bcd 1 Bicoid 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:24:38 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Lys308Ala undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:24:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Lys355Ala ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SUMO 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1e f2 As shown in Fig. 2, sumoylated Bcd products became almost undetectable in cells expressing the Bcd mutant with K308 mutated to A (referred to as BcdK308A, lane 11). A double mutation that has both K308A and K355A alterations, also had a similar effect in preventing the formation of the sumoylated Bcd products (lane 10). In contrast, individually mutating the other two lysine residues (K79 or K355) to alanines had no detectable effects on Bcd sumoylation (lanes 9 and 12). smt3-bcd-1 1 Bicoid 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Lys308Ala SUMO 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1e f2 As shown in Fig. 2, sumoylated Bcd products became almost undetectable in cells expressing the Bcd mutant with K308 mutated to A (referred to as BcdK308A, lane 11). A double mutation that has both K308A and K355A alterations, also had a similar effect in preventing the formation of the sumoylated Bcd products (lane 10). In contrast, individually mutating the other two lysine residues (K79 or K355) to alanines had no detectable effects on Bcd sumoylation (lanes 9 and 12).