UniProt UniProt http://www.uniprot.org YeeU enhances the bundling of cytoskeletal polymers of MreB and FtsZ, antagonizing the CbtA (YeeV) toxicity in Escherichia coli. YeeU enhances the bundling of cytoskeletal polymers of MreB and FtsZ, antagonizing the CbtA (YeeV) toxicity in Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Masuda H., Tan Q., Awano N., Wu K.P., Inouye M. I feel that figure 4 does not really show anything more than self-interaction of MreB and FtsZ, and seeing as that was already shown in Figure 3Ca I did not annotate Figure 4. inouye@umdnj.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Masuda H., Tan Q., Awano N., Wu K.P., Inouye M. I feel that figure 4 does not really show anything more than self-interaction of MreB and FtsZ, and seeing as that was already shown in Figure 3Ca I did not annotate Figure 4. inouye@umdnj.edu Accepted 2012-NOV-06 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation YeeU enhances the bundling of cytoskeletal polymers of MreB and FtsZ, antagonizing the CbtA (YeeV) toxicity in Escherichia coli. YeeU enhances the bundling of cytoskeletal polymers of MreB and FtsZ, antagonizing the CbtA (YeeV) toxicity in Escherichia coli. Mol. Microbiol. (0950-382X) 2012 imex curation Masuda H., Tan Q., Awano N., Wu K.P., Inouye M. I feel that figure 4 does not really show anything more than self-interaction of MreB and FtsZ, and seeing as that was already shown in Figure 3Ca I did not annotate Figure 4. inouye@umdnj.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Masuda H., Tan Q., Awano N., Wu K.P., Inouye M. I feel that figure 4 does not really show anything more than self-interaction of MreB and FtsZ, and seeing as that was already shown in Figure 3Ca I did not annotate Figure 4. inouye@umdnj.edu Accepted 2012-NOV-06 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 mreb_ecoli Cell shape-determining protein MreB mreB envB rodY b3251 JW3220 Actin-like MreB protein Rod shape-determining protein MreB protein protein ecoli Escherichia coli (strain K12) MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYPGDEVREIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE 1393696D8CDAEF93 1393696D8CDAEF93 cbea_ecoli Cytoskeleton bundling-enhancing antitoxin CbeA cbeA Antitoxin CbeA Antitoxin YeeU yeeU JW1986 b2004 protein protein ecoli Escherichia coli (strain K12) MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN E6F703DEA3D67290 yeeu-mreb 2 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3A yeeu-ftsz 2 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A mreb-yeeu 1 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3Ca, Figure 3Cc mreb 1 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) self interaction self interaction Figure 3Ca ftsz 1 3 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined self interaction self interaction Figure 3Ca ftsz-yeeu 1 3 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 3Ca and Figure 3Cc