mpidb The Microbial Protein Interaction Database Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence fluorescence technology fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. The assay relies on the reoviral scaffolding protein mu-NS, which forms large focal inclusions in yeast. When a query protein is fused to mu-NS and a likely interaction partner fused to a fluorophore, interactions can be identified by screening for yeast that form fluorescent foci. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. The assay relies on the reoviral scaffolding protein mu-NS, which forms large focal inclusions in yeast. When a query protein is fused to mu-NS and a likely interaction partner fused to a fluorophore, interactions can be identified by screening for yeast that form fluorescent foci. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 zapd_ecoli Cell division protein ZapD zapD Z ring-associated protein D yacF JW0099 b0102 protein protein ecoli Escherichia coli (strain K12) MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRFMPLDTENGQVPERLDFELACC 3C0B917A7FA844AC ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 zapd-zapd 1 5 unspecified role unspecified role prey prey region P36680-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait mu-ns fusion P36680-- fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 2 zapd-ftsz 1 6 unspecified role unspecified role prey prey region P0A9A6-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait mu-ns fusion P36680-- fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 2 zapd-zapd-1 3 5 unspecified role unspecified role unspecified role unspecified role physical association physical association supplemental figure 3B ftsz-zapd 1 6 unspecified role unspecified role bait bait mu-ns fusion fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 2, Table 2 ftsz-gtp-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 7 ftsz-gtp-3 2 5 inhibitor inhibitor unspecified role unspecified role ecoli Escherichia coli (strain K12) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction Fig. 7