MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. FEBS Lett. (0014-5793) 2012 Li Z., Liu D. suggested by lperfetto nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Li Z., Liu D. suggested by lperfetto FEBS Lett. (0014-5793) 2012 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. FEBS Lett. (0014-5793) 2012 Li Z., Liu D. suggested by lperfetto yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Liu D. suggested by lperfetto FEBS Lett. (0014-5793) 2012 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. FEBS Lett. (0014-5793) 2012 Li Z., Liu D. suggested by lperfetto nicbe Nicotiana benthamiana complementation protein complementation assay PCA complementation predetermined predetermined participant predetermined Li Z., Liu D. suggested by lperfetto FEBS Lett. (0014-5793) 2012 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. FEBS Lett. (0014-5793) 2012 Li Z., Liu D. suggested by lperfetto nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li Z., Liu D. suggested by lperfetto FEBS Lett. (0014-5793) 2012 rac10_arath Rac-like GTP-binding protein ARAC10 ARAC10 ROP11 MQB2.20 MQB2.180 At5g62880 GTPase protein ROP11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQKSNHGCLSNVLCGRIVTRH DIP protein O82481 original sequence version: 90 02575631F7582E3B rogf1_arath Rop guanine nucleotide exchange factor 1 ROPGEF1 Rho of plants guanine nucleotide exchange factor 1 Kinase partner protein-like F22I13.200 At4g38430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLSSEEDDEVSSERCGSYSPSADISESESSSSFSCHRFDGEGASSSIPSSPRVVAGRGFYFPAPVMLPVIGGKDVVWDDKQPDNDLSEIEMMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAPQKKAMWRRELEWLLCVSDSIVELIPSIQQFPGGGTYEIMETRPRSDLYANLPALKKLDAMLIDMLDAFSDTEFWYTDRGIVLGDCDKDSYNSPASVRQEDKWWLPCPKVPPNGLSEEARKKLQQCRDFANQILKAALAINSGVLAEMEIPDPYLETLPKSGKECLGEIIYQYLTANKFSPECLLDCLDLSSEHQTLEIANRIEAAVHVWRQKNGRRHKKQAKLKLSSWGGKVKGLVNDNERNDFLVQRAETLLQSLRIRFPGLPQTTLDMNKIQYNKDVGQSILESYSRVMESMAFNITARIDDVLYVDDAMRRSISVTESLSLFSINGLNPQKAFSVQSSPHGSPFATPALSVASRSPRRAPPLYSVKRNGTREKGIVGETEKAWSYAGNLSSRRVTGVTPERD DIP protein Q93ZY2 original sequence version: 48 DIP protein Q93ZY2 original sequence version: 80 DIP protein Q93ZY2 original sequence version: 60 7E6A8086E0FA5EC6 rogf9_arath Rop guanine nucleotide exchange factor 9 ROPGEF9 Rho of plants guanine nucleotide exchange factor 9 F17N18.130 At4g13240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVPSLERGISITSSFNLDRMFDSSPGKEQQQPHLAETTMPESQTQDSLGGSPVETSRPMTSRLISRRQDKQQSETEMMKDRFTKLLLGEDMSGGGKGVSSALALSNAITNLAASIFGEQTKLQPMAPDRRARWKKEIDWLLSVTDHIVEFVPSQQISKEGVCTEIMVTRQRGDLLMNIPALRKLDAMLIDTLDNFRGHNEFWYVSRDSEEGKQARNERTKDKWWLPPVKVPPNGLSESARRMLHFQKDSVSQVQKAAMAINAQVLSEMAIPDSYIESLPKNGRVSLGDSLYKSITEEWFDPEQFLSTLDLSTEHKVLDVKNRIEASIVIWKRKLHLKDNKSSWGSAVSLEKRELFEERAETILVLLKQKFPGLPQSSLDISKIQYNKDVGHAVLESYSRILESLGYTEMSRIDDVLYADSLARKQCTGEETSDGGKIATETDSASAGSSNYSGEEIEKLESQNSSKTTLLDFIGWSDNSSKGQSEKPPKSPRMTPKKLSYLEKLENLNGFRSPKDRH mint 2726C80BBBCF9AD8 rogf4_arath Rop guanine nucleotide exchange factor 4 ROPGEF4 Rho of plants guanine nucleotide exchange factor 4 F4I18.13 At2g45890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSNSDQNEGTPTSSVSSPYRRTYSDISGLSHRFDVQSFYNRPSNTNAVVLSGHEEDVSEDAEEPKDDVVNDVHGDGDEEDSDIDSAEDAELEMMRERFAKLLLGEDMSGSGKGVCTAVTVSNSITNLYATVFGQSLRLQPLSTEKKDLWKREMNCFMSICDYIVEVIPRSLGTNVEITETKLRSDILMSLPALRKLDNMLMEILDSFTENEFWYVERGSSSMNSGGGGRDSGTFRKVVVQRKDEKWWLPVPCVPAEGLSEEERKHLRHKRDCASQIHKAALAINDSTLNDMDIPDSYLTTLPKSGKASVGDVIYKQLCTAEKFYPDQLLDILKITSEHEALELADKVEASLVTWRRKTGGLTHSKSSWDMMKDISGDADRGNDKNHILAARARSLLFCLKQRYPELSQTSLDICKIQFNRDVGKAVLESYSRVLEGLAYNVVSWIDDVLYVDRTVRNRDD DIP protein Q0WNP7 original sequence version: 33 DIP protein Q0WNP7 original sequence version: 50 mint 41C2DA9959AA74C1 rogf8_arath Rho guanine nucleotide exchange factor 8 ROPGEF8 Rho of plants guanine nucleotide exchange factor 8 MOB24.21 At3g24620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAALERGLSASKSFNFKRMFDSSSTKQQQSQTIVVENGDSHIVESNTPESQNSDSFVESPVESSLPMISPLTRPGKRSERQQADMEMMKDRFAKLLLGEDMSGGGKGVSSALALSNAITNLAASIFGEQTKLQPMPQDRQARWKKEIDWLLSVTDHIVEFVPSQQTSKDGVCTEIMVTRQRGDLLMNIPALRKLDAMLIDTLDNFRGHNEFWYVSRDSEEGQQARNDRTNDKWWLPPVKVPPGGLSEPSRRMLYFQKDSVTQVQKAAMAINAQVLSEMEIPESYIDSLPKNGRASLGDSIYKSITEEWFDPEQFLAMLDMSTEHKVLDLKNRIEASVVIWKRKLHTKDTKSSWGSAVSLEKRELFEERAETILVLLKQKFPGLPQSSLDISKIQFNKDVGQAVLESYSRILESLAYTVMSRIEDVLYTDTLALKQTLLAEETSDGGRTTETDSESAGSSNSGEEAEKHDPHSKTLLDFMGWNDNSSKGGDKPTKSPNLTPKKLSYLEKLENLNGFRSPKDRH mint F84808EC9F70811F rogf2_arath Rop guanine nucleotide exchange factor 2 ROPGEF2 Rho of plants guanine nucleotide exchange factor 2 T1N6.8 At1g01700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAYHRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETDEHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSGKASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSKSSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGEE mint E7C2574C8810E4EA arac10-ropgef1 3 Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ROPGEF1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint arac10-ropgef2 3 ROPGEF2 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint arac10-ropgef4 3 ROPGEF4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint arac10-ropgef8 3 ROPGEF8 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint arac10-f17n18_130 3 ROPGEF9 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint ropgef1-arac10 2 ROPGEF1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint ropgef2-arac10 2 ROPGEF2 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint ropgef4-arac10 2 ROPGEF4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint ropgef8-arac10 2 ROPGEF8 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint f17n18_130-arac10 2 ROPGEF9 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint arac10-ropgef1-1 1 Rop11 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ROPGEF1 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint arac10-ropgef4-1 1 ROPGEF4 8 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint arac10-ropgef1-2 4 Rop11 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ROPGEF1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3C mint arac10-ropgef4-2 4 ROPGEF4 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rop11 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3C mint