IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... Wild-type human skin fibroblasts. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... Skin fibroblasts were used from a human patient who is homozygous for the common BBS10 mutation, c91fsX95. This is a truncating, frameshift, mutation caused by a single-nucleotide insertion (at residue 91), leading to premature termination four codons later. (Stoetzel C et al., Nat Genet. 2006) The authors state that the mutation is predicted to result in total absence of the BBS10 protein. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. J. Biol. Chem. (0021-9258) 2012 imex curation Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. I have added 2 complexes from this publication to the Curated-complex (human-temp) "publication". This paper was "reserved" by Lucasz - not any more... It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation pthb1_mouse Protein PTHB1 Bbs9 Pthb1 Bardet-Biedl syndrome 9 protein homolog Parathyroid hormone-responsive B1 gene protein homolog protein protein mouse Mus musculus Mouse MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLNIGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVSSTLDSVSQATNVEPGADSVPSITVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTDRNPDGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFELRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQVIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQELGWEETVDAAIAYLLKTCLSKSSKEQALNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPGGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPEVSARQGVLE 46C4580518630E36 bbip1_human BBSome-interacting protein 1 BBIP1 NCRNA00081 BBIP10 BBSome-interacting protein of 10 kDa protein protein human Homo sapiens Human MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH 25F2EE32DF0B948D bbs4_mouse Bardet-Biedl syndrome 4 protein homolog Bbs4 protein protein mouse Mus musculus Mouse MAEVKLGMKTQVPASVESQKPRSKKAPDFPIVEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQCADNLKQVARSLFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLTYIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVYQKAFEHLGNALTYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENARRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKSALAQYQEMEKKVNFLKDNSPLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKTKHRTNSGSKSATLQQPLGSIQALGQAMSSAAAYRKILSGAVGAQLPKPPSLPLEPEPEPTVEASPTEASEQKKEK DIP protein Q8C1Z7 original sequence version: 69 70640E41509F2479 bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 322E9DD4DD554813 bbs10_human Bardet-Biedl syndrome 10 protein BBS10 C12orf58 protein protein human Homo sapiens Human MLSSMAAAGSVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRLLEALHLEHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLMCENIQTHGRHWKNCSRWKFISQALLTFQTQILDGIMDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFWIMEKTKAIMKHLHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIGLSPFVPPQAFSQCEIPNTALVKFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQHEDALHGALKMLRQLFKDLDLNYMTQTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDALEKTQTYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLTDYYEPLLKNNSTAYSTRGNRIEISYENLQVTNITRKGSMLPVSCKLPNMGTSQSYLSSSMPAGCVLPVGGNFEILLHYYLLNYAKKCHQSEETMVSMIIANALLGIPKVLYKSKTGKYSFPHTYIRAVHALQTNQPLVSSQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL DIP protein Q8TAM1 original sequence version: 73 558143FFA5F191DD bbs5_mouse Bardet-Biedl syndrome 5 protein homolog Bbs5 protein protein mouse Mus musculus Mouse MSVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS 8FD2BF5943F72325 bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS DIP protein Q8N3I7 original sequence version: 95 DIP protein Q8N3I7 original sequence version: 69 63D67D877FDFD25B pcm1_human Pericentriolar material 1 protein PCM1 protein protein human Homo sapiens Human MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDASTNPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTLRDQHLNNSSASPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESENEGHLNPSEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEVNSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPSLDCRYNREGEQEIHVAQGEDDEEEEEEAEEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTACPDLQLSAASVGNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRRKQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFSADENYRPLAKTRQQNISMQRQENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHFIMHQLNQCYTQLTWQQNNVQRLKQMLNELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQPVNLFNIPGFTNFSSFAPGMNFSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIGAEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLESFSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFERETHKISEQNDADNASVLSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNMRCTCRIIEDGDGAGAGTTVNNLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDKDKDETETVKQTQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQTSLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATSKNDQNNCPVKPCYLNILEDEQPLNSAAHKESPPTVDSTQQPNPLPLRLPEMEPLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI DIP protein Q15154 original sequence version: 101 DIP protein Q15154 original sequence version: 124 4625B991A443B6F3 ttc8_human Tetratricopeptide repeat protein 8 TTC8 BBS8 Bardet-Biedl syndrome 8 protein protein protein human Homo sapiens Human MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML DIP protein Q8TAM2 original sequence version: 114 DIP protein Q8TAM2 original sequence version: 85 013CFB0FDEBF385B tcpa_human T-complex protein 1 subunit alpha CCTA TCP1 CCT1 CCT-alpha protein protein human Homo sapiens Human MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND DIP protein P17987 original sequence version: 114 DIP protein P17987 original sequence version: 123 486ECA836EA258A1 bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C bbs12_human Bardet-Biedl syndrome 12 protein BBS12 C4orf24 protein protein human Homo sapiens Human MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPDGFQEHVTATHKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQQGNCTKPFMFDISRIFTCCLPGLPETSSCVCPGYITVVSVSNNPVIKELQNQPVRIVLIEGDLTENYRHLGFNKSANIKTVLDSMRLQEDSSEELWANHVLQVLIQFKVNLVLVQGNVSERLIEKCINSKRLVIGSVNGSVMQAFAEAAGAVQVAYITQVNEDCVGDGVCVTFWRSSPLDVVDRNNRIAILLKTEGINLVTAVLTNPVTAQMQIKEDRFWTCAYRLYYALKEEKVFLGGGAVEFLCLSCLHILAEQSLKKENHACSGWLHNTSSWLASSLAIYRPTVLKFLANGWQKYLSTLLYNTANYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFLFL DIP protein Q6ZW61 original sequence version: 58 F441A12526A23B40 pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE DIP protein Q3SYG4 original sequence version: 47 8E333B7680243B7A bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS DIP protein Q9CWF6 original sequence version: 63 C91D9B7834B614F4 mkks_human McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin Bardet-Biedl syndrome 6 protein MKKS BBS6 protein protein human Homo sapiens Human MSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVTHPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRIPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMTGTQPIGSLGSICPNSYGSVKDVCTAKFGSKHFFHLIPNEATICSLLLCNRNDTAWDELKLTCQTALHVLQLTLKEPWALLGGGCTETHLAAYIRHKTHNDPESILKDDECTQTELQLIAEAFCSALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANWPDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTLDCLTAKLSGLQVAVETANLILDLSYVIEDKN DIP protein Q9NPJ1 original sequence version: 122 DIP protein Q9NPJ1 original sequence version: 95 14BA57FF8AEA0AF7 ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML DIP protein Q8VD72 original sequence version: 76 9A8ACDF59BB641C1 bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA DIP protein Q8K2G4 original sequence version: 52 F7D8C284B04DA15B bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF tcpb_human T-complex protein 1 subunit beta CCT2 99D8.1 CCTB CCT-beta protein protein human Homo sapiens Human MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC DIP protein P78371 original sequence version: 101 DIP protein P78371 original sequence version: 107 57F9E1720D84A31F bbs7-bbs1 5 25 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey association association Fig 1A The mutant BBS7T211I has a decreased ability to interact with endogenous BBSome subunits compared with WT BBS7, however it pulls down relatively more BBS2 than other BBSome proteins. bbs7-bbs1-1 5 17 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1B Knockdown of BBS2 decreases the association of BBS7 with BBS1, while knockdown of BBS1 does not affect the association of BBS7 with BBS2. I assume this is another IP - though cannot see this is stated anywhere.. bbs9-bbsx 5 20 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey association association Fig 1C Despite what the text says I see NO interaction between BBS9 and BBS1+4 - so not entered. bbip1-bbs7 5 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1C bbs5-bbs1 5 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey association association Fig 1C bbs5-bbs1 5 25 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey association association Fig 1C bbs2-bbs1-1 5 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig 1D Knockdown of BBS9 greatly decreases the association of BBS1, BBS4, and BBS8 with BBS2, but does not affect the association of BBS7 with BBS2. bbs1-bbs2-2 3 23 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component Q3V3N7:p.Met390Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M R Wed May 02 16:11:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met390arg' Tue Jun 30 17:02:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met390Arg' colocalization colocalization Fig 2B, 3A. The BBS1 M390R mutation associates normally with all BBSome proteins, except for BBS4. bbs1-bbs2-4 6 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey Q3V3N7:p.Met390Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain M R Wed May 02 17:42:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met390arg' Tue Jun 30 18:28:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met390Arg' association association Fig 2C, 3B. Using Bbs1 M390R/M390R mutant mice, BBS1 is missing from the complex along with BBS4. I feel there should be another way of annotating the reduced reaction using the mutant mouse strain, but there does not seem much point in enterering an identical IP with 2 less participants - and no mutant... bbs2-bbs1-2 2 17 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2D bbs4-bbip1 2 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey Q8NFJ9:p.Met390Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain M R Wed May 02 15:50:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met390arg' Tue Jun 30 17:35:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met390Arg' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2D BBS1 M390R mutant protein has greatly reduced interaction with BBS4, but normal interactions with BBS9 and BBS2. bbs9-bbs1-3 2 17 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2D bbs1-bbs2-5 3 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 3A. Loss of BBS4 does not affect the incorporation of other BBSome subunits (including BBS1) into the BBSome. bbs2-bbs1-3 6 24 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait association association Fig 3B. Loss of BBS4 does not affect the incorporation of other BBSome subunits (including BBS1) into the BBSome. pcm1-bbs1 2 14 unspecified role unspecified role bait bait c_terminus sufficient to bind sufficient binding region sufficient to bind range range range range region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey Q96RK4:p.Arg295Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R P Wed May 02 19:42:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg295pro' Tue Jun 30 18:23:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg295Pro' Q96RK4:p.Gly277Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 16:30:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly277glu' Tue Jun 30 17:31:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly277Glu' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A bbs4-pcm1-9 2 14 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus sufficient to bind sufficient binding region sufficient to bind range range range range 18 unspecified role unspecified role bait bait Q96RK4:p.Gly277Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 15:46:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly277glu' Tue Jun 30 17:27:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly277Glu' Q96RK4:p.Arg295Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R P Wed May 02 19:43:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg295pro' Tue Jun 30 17:11:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg295Pro' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A mkks-bbs7-1 5 27 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5A Absence of BBS10 decreases the interaction of BBS6 with TCPalpha and TCPbeta. mkks-bbs7-3 5 11 unspecified role unspecified role ancillary ancillary region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey association association Fig 5B Overexpression of BBS10 promotes the interaction of BBS6 with TCPalpha and TCPbeta. mkks-bbs2 5 22 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Fig 6A despite what the text says, I can see no other positive bands.-so nothing else entered. bbs2-bbs5 5 26 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A bbs7-cct2 5 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey association association Fig 6B bbs7-cct2-1 5 25 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey association association Fig 6B bbs2-bbs7 2 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2A bbs7-bbs1-2 2 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2A bbs7-bbs9 2 25 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S2B -1 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs9-bbs7 2 20 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S2B -2 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs2-bbs9-1 2 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2B -3 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs2-bbs9-2 2 26 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2B -4 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbip1-bbs4 2 14 unspecified role unspecified role unspecified role unspecified role c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig S3A bbs4-pcm1-11 2 8 unspecified role unspecified role unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role unspecified role unspecified role n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig S3A bbip1-pcm1 2 18 unspecified role unspecified role ancillary ancillary n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S3B PCM1 can interact with BBIP10 only when BBS4 is present. pcm1-bbip1 2 18 unspecified role unspecified role ancillary ancillary n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S3B PCM1 can interact with BBIP10 only when BBS4 is present. mkks-bbs12-1 2 19 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role ancillary ancillary association association S4A The interaction of BBS6 with BBS12 requires BBS7. bbs7-bbs12 2 26 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4B Although the text states:-"The interaction of BBS7 with BBS12 requires BBS6." - however there is a clearly visible band when the antibody used for IP is anti-myc, even when BBS6-siRNA is present. this interaction has been moved here from Expt 6 as the "no-uniprot update" is not needed - due to the visible band! (???!) -so it is a "real" interaction? bbs12-bbs7-1 2 26 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role ancillary ancillary association association S4B -2 The interaction of BBS7 with BBS12 requires BBS6. bbs12-mkks 2 22 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role ancillary ancillary association association S4A -2 The interaction of BBS6 with BBS12 requires BBS7. bbs7-bbs12-2 2 22 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPJ1:p.Thr57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 20:19:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr57ala' Tue Jun 30 17:13:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr57Ala' 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4C as for fig S4B - I have included this interaction here, as there is a clear band shown for the "control" - no HA- BBS6 present. bbs12-bbs7-2 2 26 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPJ1:p.Thr57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:34:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr57ala' Tue Jun 30 18:15:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr57Ala' association association S4C-2 bbs1-bbs2-6 4 17 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component association association Fig S6B -2 Absence of BBS10 lowers BBS2 protein levels and inhibits BBSome formation. bbs2-bbs5-2 1 26 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component association association Fig S6B