mpidb The Microbial Protein Interaction Database The ExbD periplasmic domain contains distinct functional regions for two stages in TonB energization. The ExbD periplasmic domain contains distinct functional regions for two stages in TonB energization. J. Bacteriol. (0021-9193) 2012 imex curation Ollis A.A., Kumar A., Postle K. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Ollis A.A., Kumar A., Postle K. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK DIP protein P0ABV2 original sequence version: 70 25A539A2FAEB9F6C tonb_ecoli Protein TonB tonB exbA JW5195 b1252 protein protein ecoli Escherichia coli (strain K12) MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ DIP protein P02929 original sequence version: 99 3B59F39D791AE815 exbb_ecoli Biopolymer transport protein ExbB JW2974 b3006 exbB protein protein ecoli Escherichia coli (strain K12) MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQKLRAG DIP protein P0ABU7 original sequence version: 37 DIP protein P0ABU7 original sequence version: 72 CEB63893A80BA71F exbd-1 1 2 unspecified role unspecified role neutral component neutral component region P0ABV2-112-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 4A exbb-exbd-3 1 4 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component region P0ABV2-112-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 4A exbd-p02929-4 1 2 unspecified role unspecified role neutral component neutral component region P0ABV2-132-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component physical association physical association figure 4