UniProt UniProt http://www.uniprot.org Sin3 interacts with Foxk1 and regulates myogenic progenitors. Sin3 interacts with Foxk1 and regulates myogenic progenitors. Mol. Cell. Biochem. (0300-8177) 2012 imex curation Shi X., Garry D.J. garry@umn.edu 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shi X., Garry D.J. garry@umn.edu Accepted 2012-NOV-23 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biochem. (0300-8177) 2012 Only protein-protein interactions imex curation Sin3 interacts with Foxk1 and regulates myogenic progenitors. Sin3 interacts with Foxk1 and regulates myogenic progenitors. Mol. Cell. Biochem. (0300-8177) 2012 imex curation Shi X., Garry D.J. garry@umn.edu 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecobb Escherichia coli (strain B / BL21) pull down pull down western blot western blot Immuno blot Immuno blot Shi X., Garry D.J. garry@umn.edu Accepted 2012-NOV-23 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biochem. (0300-8177) 2012 Only protein-protein interactions imex curation foxk1_mouse Forkhead box protein K1 Myocyte nuclear factor Foxk1 Mnf protein protein mouse Mus musculus Mouse MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPATTSPPPPAQPPPGPPALPAEPGPGPVPSTVATATTTAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADASGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGLQTPECLSREGSPIPHDPDLGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAPGVPGHTVTILQPATPVTIGQHHLPVRAVTQNGKHAVPTNSLTGNAYALSSPLQLLAAQASSSTPVVITRVCEVGPEEPAAAVSVAANAAPTPAASTTTSASSSGEPEVKRSRVEEPGGTATTQPTAMAATGPQGPGTGE 0A0D3049B7846328 q62141-2 Paired amphipathic helix protein Sin3b Sin3b Kiaa0700 Histone deacetylase complex subunit Sin3b Transcriptional corepressor Sin3b protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE 11A75E8F67C818AE foxk1-sin3b-4 1 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 7 physical association physical association Figure 1a, 1b foxk1-sin3b-3 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association Figure 2 a, b, c, d sin3b-foxk1 2 3 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 16 19 physical association physical association Figure 2 a, b, c, d